"Ccl8" Related Products

Expand
Expand
Expand

Recombinant Mouse Ccl8 protein

Cat.No. : Ccl8-100M
Product Overview : Recombinant Mouse Ccl8 protein was expressed in Escherichia coli.
Description : Murine CCL8, also known as monocyte chemotactic protein 2 (MCP-2), is belonging to the CC chemokine family and is encoded by the gene CCL8 in mouse. MCP-2 has two homogeneous MCP-1 (CCL2) and MCP-3 (CCL7). These three MCPs were found by IL-1-beta triggered human MG-63 osteosarcoma cells. CCL8 shares 62 % amino acid sequence identity with MCP-1, and shares 58 % amino acid sequence identity with MCP-2. CCL8 has chemotactic fuction for monocytes, eosinophils and neutrophils. In addition, it can also chemoattract activated NK cells.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids.
Protein length : 74
AA Sequence : GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Endotoxin : Less than 1 EU/μg of rMuMCP-2/CCL8 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : Ccl8
Official Symbol : Ccl8
Synonyms : CCL8; chemokine (C-C motif) ligand 8; C-C motif chemokine 8; small inducible cytokine A8; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; monocyte chemoattractant protein-2; HC14; Mcp2; MCP-2; Scya8; AB023418; 1810063B20Rik;
Gene ID : 20307
mRNA Refseq : NM_021443
Protein Refseq : NP_067418
UniProt ID : Q9Z121

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.