"Pspn" Related Products

Recombinant Mouse Pspn protein

Cat.No. : Pspn-21M
Product Overview : Recombinant Mouse Pspn protein was expressed in Escherichia coli.
Description : This gene encodes a secreted ligand of the GDNF (glial cell line-derived neurotrophic factor) subfamily and TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein signals through the RET receptor tyrosine kinase and a GPI-linked coreceptor, and promotes survival of neuronal populations. This protein may play a role in cell death, and nervous system development and function. Elevated expression of this gene has been observed in oral squamous cell carcinoma.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 % ACN, 0.1 % TFA, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TT medullary thyroid cancer cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg.
Molecular Mass : Approximately 20.7 kDa, a disulfide-linked homodimer of two 96 amino acid polypeptide chains.
Protein length : 96
AA Sequence : ALAGSCRLWSLTLPVAELGLGYASEEKVIFRYCAGSCPQEARTQHSLVLARLRGRGRAHGRPCCQPTSYADVTFLDDQHHWQQLPQLSAAACGCGG
Endotoxin : Less than 0.1 EU/µg of rMuPersephin as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : Pspn
Official Symbol : Pspn
Synonyms : PSPN; persephin; PSP;
Gene ID : 19197
mRNA Refseq : NM_008954
Protein Refseq : NP_032980
UniProt ID : O70300

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.