"BDNF" Related Products

Expand
Expand

Recombinant Human Brain-derived Neurotrophic Factor, His-tagged

Cat. No.: BDNF-231H
Product Overview: Recombinant Human brain-derived neurotrophic factor encoding the mature human BDNF (His129- Arg247) with 6 His tag on the N-Terminus was expressed inE. Coli.This protein was purified by Ni-NTA column. MW=16 KDa.
Description: BDNF belongs to NGF family. Monomers and homodimers bind to NTRK2/TRKB. The propeptide is N‐glycosylated and glycosulfated. The pro‐BDNF was converted into mature BDNF by plasmin. BDNF promotes the survival of neuronal populations that are all located either in the central nervous system or directly connected to it. It is a major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS.
Source: E. Coli.
Sequence: Mature Human BDNF (His129‐Arg247)HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMG YTKEGCRGID KRHWNSQCRT TQSYVRALTM DSKKRIGWRF IRIDTSCVCT LTIKRGR.
Purity: > 95% in SDS-PAGE.
Formulation: Lyophilized 100 μg human BDNF in 50 μl of TBS ( 20 mM Tris, 50mM NaCl, pH8.0 ). Carry free (Does NOT contain BSA).
Reconstitution: Add 500μl deionized water or TBS to the vial to prepare a working stock solution at 200 μg/mL. Allow to set at least 30 minutes at 4℃, mix well.
Application: BA, ELISA.
Storage: Store lyophilized protein at -20℃ to-70℃. Lyophilized protein is stable for up to 6 months from date of receipt at - 20℃ to -70℃. Upon reconstitution, this protein can be stored at -20℃ for up to a few weeks or at -70℃ in a manual defrost freezer for long term storage (six months). Aliquot reconstituted protein to avoid repeated freeze / thaw cycles.
Gene Name: BDNF brain-derived neurotrophic factor [ Homo sapiens ]
Synonyms: BDNF;brain-derived neurotrophic factor; MGC34632; Abrineurin; neurotrophin; Brain-derived neurotrophic factor
Gene ID: 627
mRNA Refseq: NM_001143805
Protein Refseq: NP_001137277
MIM: 113505
UniProt ID: P23560
Chromosome Location: 11p13
Pathway: Huntington"s disease; MAPK signaling pathway; Neurotrophin signaling pathway
Function: Growth factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.