Recombinant Human BDNF Protein, His-tagged

Cat.No. : BDNF-02H
Product Overview : Recombinant human BDNF protein (19-128a.a) fused to a 6 a.a His tag at C-terminal was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 19-128
Description : The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene.
Form : Filtered White lyophilized (freeze-dried) powder.
AA Sequence : APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH.
Purity : Greater than 95.0% as determined by SDS-PAGE.
Notes : Our products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Stability : Store lyophilized protein at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade.
Storage Buffer : BDNF filtered (0.4 μm) and lyophilized from 0.5mg/ml in PBS.
Reconstitution : It is recommended to add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.
Shipping : Shipped at Room temperature.
Gene Name BDNF brain derived neurotrophic factor [ Homo sapiens (human) ]
Official Symbol BDNF
Synonyms BDNF; brain derived neurotrophic factor; ANON2; BULN2; brain-derived neurotrophic factor; abrineurin; neurotrophin
Gene ID 627
mRNA Refseq NM_170735
Protein Refseq NP_733931
MIM 113505
UniProt ID P23560

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BDNF Products

Required fields are marked with *

My Review for All BDNF Products

Required fields are marked with *

0
cart-icon
0
compare icon