| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
95 |
| Description : |
Chemokine (C-C motif) ligand 27 (CCL27) is a small cytokine belonging to the CC chemokine family also known under the names IL-11 R-alpha-locus chemokine (ILC), Skinkine, ESkine and Cutaneous T-cell-attracting chemokine (CTACK). It is associated with homing of memory T lymphocytes to the skin, and plays a role in T cell-mediated inflammation of the skin. CCL27 is expressed in numerous tissues, including gonads, thymus, placenta and skin. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, with 5% trehalose. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood lymphocytes is in a concentration range of 10-100 ng/ml. |
| Molecular Mass : |
Approximately 10.9 kDa, a single, non-glycosylated polypeptide chain containing 95 amino acids. |
| AA Sequence : |
LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN |
| Endotoxin : |
Less than 1 EU/µg of rMuCTACK/CCL27 as determined by LAL method. |
| Purity : |
>98% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
