Recombinant Mouse Ccl27a protein

Cat.No. : Ccl27a-118M
Product Overview : Recombinant Mouse Ccl27a protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 95
Description : Chemokine (C-C motif) ligand 27 (CCL27) is a small cytokine belonging to the CC chemokine family also known under the names IL-11 R-alpha-locus chemokine (ILC), Skinkine, ESkine and Cutaneous T-cell-attracting chemokine (CTACK). It is associated with homing of memory T lymphocytes to the skin, and plays a role in T cell-mediated inflammation of the skin. CCL27 is expressed in numerous tissues, including gonads, thymus, placenta and skin.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, with 5% trehalose.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood lymphocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 10.9 kDa, a single, non-glycosylated polypeptide chain containing 95 amino acids.
AA Sequence : LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN
Endotoxin : Less than 1 EU/µg of rMuCTACK/CCL27 as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl27a
Official Symbol Ccl27a
Synonyms CCL27A; chemokine (C-C motif) ligand 27A; C-C motif chemokine 27; skinkine; skinskine; CC chemokine ILC; small inducible cytokine A27; small-inducible cytokine A27; IL-11 R-alpha-locus chemokine; small inducible cytokine A27a; chemokine (C-C motif) ligand 27; cutaneous T-cell-attracting chemokine; ALP; ILC; CTAK; CTACK; Ccl27; PESKY; ESkine; Scya27; Scya27a; AW558992; MGC130150;
Gene ID 20301
mRNA Refseq NM_001048179
Protein Refseq NP_001041644
UniProt ID Q9Z1X0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl27a Products

Required fields are marked with *

My Review for All Ccl27a Products

Required fields are marked with *

0
cart-icon