Recombinant Mouse Ccl27a protein
Cat.No. : | Ccl27a-118M |
Product Overview : | Recombinant Mouse Ccl27a protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 95 |
Description : | Chemokine (C-C motif) ligand 27 (CCL27) is a small cytokine belonging to the CC chemokine family also known under the names IL-11 R-alpha-locus chemokine (ILC), Skinkine, ESkine and Cutaneous T-cell-attracting chemokine (CTACK). It is associated with homing of memory T lymphocytes to the skin, and plays a role in T cell-mediated inflammation of the skin. CCL27 is expressed in numerous tissues, including gonads, thymus, placenta and skin. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, with 5% trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood lymphocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 10.9 kDa, a single, non-glycosylated polypeptide chain containing 95 amino acids. |
AA Sequence : | LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN |
Endotoxin : | Less than 1 EU/µg of rMuCTACK/CCL27 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl27a |
Official Symbol | Ccl27a |
Synonyms | CCL27A; chemokine (C-C motif) ligand 27A; C-C motif chemokine 27; skinkine; skinskine; CC chemokine ILC; small inducible cytokine A27; small-inducible cytokine A27; IL-11 R-alpha-locus chemokine; small inducible cytokine A27a; chemokine (C-C motif) ligand 27; cutaneous T-cell-attracting chemokine; ALP; ILC; CTAK; CTACK; Ccl27; PESKY; ESkine; Scya27; Scya27a; AW558992; MGC130150; |
Gene ID | 20301 |
mRNA Refseq | NM_001048179 |
Protein Refseq | NP_001041644 |
UniProt ID | Q9Z1X0 |
◆ Recombinant Proteins | ||
CCL27A-8690Z | Recombinant Zebrafish CCL27A | +Inquiry |
Ccl27a-657M | Active Recombinant Mouse Ccl27a | +Inquiry |
Ccl27a-118M | Recombinant Mouse Ccl27a protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl27a Products
Required fields are marked with *
My Review for All Ccl27a Products
Required fields are marked with *
0
Inquiry Basket