"ACSL3" Related Products

Expand

Recombinant Human ACSL3, His-tagged

Cat.No.: ACSL3-26480TH
Product Overview: Recombinant fragment, corresponding to amino acids 535-720 of Human ACSL3 with an N terminal His tag; MWt 25 kDa
Description: The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 91 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCL KIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICA YANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCN SCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWT PETGLVTDAFKLKRKELKTHYQADIERMYGRK
Gene Name: ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ]
Official Symbol: ACSL3
Synonyms: ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194;
Gene ID: 2181
mRNA Refseq: NM_004457
Protein Refseq: NP_004448
MIM: 602371
Uniprot ID: O95573
Chromosome Location: 2q34-q35
Pathway: Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem;
Function: ATP binding; fatty-acyl-CoA synthase activity; ligase activity; long-chain fatty acid-CoA ligase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.