Recombinant Human ACSL3, His-tagged
Cat.No. : | ACSL3-26480TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 535-720 of Human ACSL3 with an N terminal His tag; MWt 25 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 535-720 a.a. |
Description : | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 91 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCL KIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICA YANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCN SCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWT PETGLVTDAFKLKRKELKTHYQADIERMYGRK |
Gene Name | ACSL3 acyl-CoA synthetase long-chain family member 3 [ Homo sapiens ] |
Official Symbol | ACSL3 |
Synonyms | ACSL3; acyl-CoA synthetase long-chain family member 3; FACL3, fatty acid Coenzyme A ligase, long chain 3; long-chain-fatty-acid--CoA ligase 3; ACS3; PRO2194; |
Gene ID | 2181 |
mRNA Refseq | NM_004457 |
Protein Refseq | NP_004448 |
MIM | 602371 |
Uniprot ID | O95573 |
Chromosome Location | 2q34-q35 |
Pathway | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem; |
Function | ATP binding; fatty-acyl-CoA synthase activity; ligase activity; long-chain fatty acid-CoA ligase activity; nucleotide binding; |
◆ Recombinant Proteins | ||
ACSL3-3788H | Recombinant Human ACSL3 protein, His-tagged | +Inquiry |
ACSL3-261H | Recombinant Human ACSL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACSL3-15H | Recombinant Human ACSL3 protein, His-tagged | +Inquiry |
RFL-34899HF | Recombinant Full Length Human Long-Chain-Fatty-Acid--Coa Ligase 3(Acsl3) Protein, His-Tagged | +Inquiry |
ACSL3-53H | Recombinant Human ACSL3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL3-9077HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
ACSL3-9076HCL | Recombinant Human ACSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACSL3 Products
Required fields are marked with *
My Review for All ACSL3 Products
Required fields are marked with *