"ADH5" Related Products

Expand
Expand
Expand

Recombinant Human ADH5, His-tagged

Cat.No.: ADH5-27095TH
Product Overview: Recombinant fragment, corresponding to amino acids 111-374 of Human ADH5 with an N terminal His tag. Predicted mwt: 29 kDa;
Description: This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 105 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYT VVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAK LEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDK FARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSF ECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATR PFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDE FVTHNLSFDEINKAFELMHSGKSIRTVVKI
Gene Name: ADH5 alcohol dehydrogenase 5 (class III), chi polypeptide [ Homo sapiens ]
Official Symbol: ADH5
Synonyms: ADH5; alcohol dehydrogenase 5 (class III), chi polypeptide; FDH, formaldehyde dehydrogenase; alcohol dehydrogenase class-3; ADH 3; ADHX;
Gene ID: 128
mRNA Refseq: NM_000671
Protein Refseq: NP_000662
MIM: 103710
Uniprot ID: P11766
Chromosome Location: 4q23
Pathway: Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem;
Function: S-(hydroxymethyl)glutathione dehydrogenase activity; alcohol dehydrogenase (NAD) activity; electron carrier activity; fatty acid binding; formaldehyde dehydrogenase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.