"ADH5" Related Products

Expand
Expand
Expand

Recombinant Human ADH5, His-tagged

Cat.No.: ADH5-27095TH
Product Overview: Recombinant fragment, corresponding to amino acids 111-374 of Human ADH5 with an N terminal His tag. Predicted mwt: 29 kDa;
Description: This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 105 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYT VVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAK LEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDK FARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSF ECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATR PFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDE FVTHNLSFDEINKAFELMHSGKSIRTVVKI
Gene Name: ADH5 alcohol dehydrogenase 5 (class III), chi polypeptide [ Homo sapiens ]
Official Symbol: ADH5
Synonyms: ADH5; alcohol dehydrogenase 5 (class III), chi polypeptide; FDH, formaldehyde dehydrogenase; alcohol dehydrogenase class-3; ADH 3; ADHX;
Gene ID: 128
mRNA Refseq: NM_000671
Protein Refseq: NP_000662
MIM: 103710
Uniprot ID: P11766
Chromosome Location: 4q23
Pathway: Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem;
Function: S-(hydroxymethyl)glutathione dehydrogenase activity; alcohol dehydrogenase (NAD) activity; electron carrier activity; fatty acid binding; formaldehyde dehydrogenase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.