"ADSL" Related Products

Expand

Recombinant Human ADSL, His-tagged

Cat.No.: ADSL-26897TH
Product Overview: Recombinant full length protein, (amino acids 1-484) of Human Adenylosuccinate Lyase with N terminal His tag; 520 amino acids, 59 kDa inclusive of tag.
Description: Adenylsuccinate lyase is involved in both de novo synthesis of purines and formation of adenosine monophosphate from inosine monophosphate. It catalyzes two reactions in AMP biosynthesis: the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to give aminoimidazole carboxamide ribotide (AICA) and removal of fumarate from adenylosuccinate to give AMP. Adenylosuccinase deficiency results in succinylpurinemic autism, psychomotor retardation, and , in some cases, growth retardation associated with muscle wasting and epilepsy. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 484 amino acids
Conjugation: HIS
Molecular Weight: 59.000kDa inclusive of tags
Source: E. coli
Tissue specificity: Ubiquitously expressed. Both isoforms are produced by all tissues. Isoform 2 is 10-fold less abundant than isoform 1.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 40% Glycerol, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL
Sequence Similarities: Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily.
Gene Name: ADSL adenylosuccinate lyase [ Homo sapiens ]
Official Symbol: ADSL
Synonyms: ADSL; adenylosuccinate lyase;
Gene ID: 158
mRNA Refseq: NM_000026
Protein Refseq: NP_000017
MIM: 608222
Uniprot ID: P30566
Chromosome Location: 22q13.1
Pathway: Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Inosine monophosphate biosynthesis, PRPP + glutamine => IMP, organism-specific biosystem; Inosine monophosphate biosynthesis, PRPP + glutamine =>
Function: (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate AMP-lyase (fumarate-forming) activity; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity; NOT N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity; N6-(1,2-;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.