Recombinant Human ADSL, His-tagged
Cat.No. : | ADSL-26897TH |
Product Overview : | Recombinant full length protein, (amino acids 1-484) of Human Adenylosuccinate Lyase with N terminal His tag; 520 amino acids, 59 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 484 amino acids |
Description : | Adenylsuccinate lyase is involved in both de novo synthesis of purines and formation of adenosine monophosphate from inosine monophosphate. It catalyzes two reactions in AMP biosynthesis: the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to give aminoimidazole carboxamide ribotide (AICA) and removal of fumarate from adenylosuccinate to give AMP. Adenylosuccinase deficiency results in succinylpurinemic autism, psychomotor retardation, and , in some cases, growth retardation associated with muscle wasting and epilepsy. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 59.000kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. Both isoforms are produced by all tissues. Isoform 2 is 10-fold less abundant than isoform 1. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 40% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL |
Sequence Similarities : | Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily. |
Gene Name | ADSL adenylosuccinate lyase [ Homo sapiens ] |
Official Symbol | ADSL |
Synonyms | ADSL; adenylosuccinate lyase; |
Gene ID | 158 |
mRNA Refseq | NM_000026 |
Protein Refseq | NP_000017 |
MIM | 608222 |
Uniprot ID | P30566 |
Chromosome Location | 22q13.1 |
Pathway | Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Inosine monophosphate biosynthesis, PRPP + glutamine => IMP, organism-specific biosystem; Inosine monophosphate biosynthesis, PRPP + glutamine => |
Function | (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate AMP-lyase (fumarate-forming) activity; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity; NOT N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity; N6-(1,2-; |
◆ Recombinant Proteins | ||
ADSL-10270Z | Recombinant Zebrafish ADSL | +Inquiry |
Adsl-3187M | Recombinant Mouse Adsl, His-tagged | +Inquiry |
Adsl-549M | Recombinant Mouse Adsl Protein, MYC/DDK-tagged | +Inquiry |
ADSL-26897TH | Recombinant Human ADSL, His-tagged | +Inquiry |
ADSL-0288H | Recombinant Human ADSL Protein (M1-L484), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADSL-8995HCL | Recombinant Human ADSL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADSL Products
Required fields are marked with *
My Review for All ADSL Products
Required fields are marked with *
0
Inquiry Basket