Recombinant Human ADSL, His-tagged

Cat.No. : ADSL-26897TH
Product Overview : Recombinant full length protein, (amino acids 1-484) of Human Adenylosuccinate Lyase with N terminal His tag; 520 amino acids, 59 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 484 amino acids
Description : Adenylsuccinate lyase is involved in both de novo synthesis of purines and formation of adenosine monophosphate from inosine monophosphate. It catalyzes two reactions in AMP biosynthesis: the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to give aminoimidazole carboxamide ribotide (AICA) and removal of fumarate from adenylosuccinate to give AMP. Adenylosuccinase deficiency results in succinylpurinemic autism, psychomotor retardation, and , in some cases, growth retardation associated with muscle wasting and epilepsy. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Molecular Weight : 59.000kDa inclusive of tags
Tissue specificity : Ubiquitously expressed. Both isoforms are produced by all tissues. Isoform 2 is 10-fold less abundant than isoform 1.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 40% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKAELCL
Sequence Similarities : Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily.
Gene Name ADSL adenylosuccinate lyase [ Homo sapiens ]
Official Symbol ADSL
Synonyms ADSL; adenylosuccinate lyase;
Gene ID 158
mRNA Refseq NM_000026
Protein Refseq NP_000017
MIM 608222
Uniprot ID P30566
Chromosome Location 22q13.1
Pathway Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Inosine monophosphate biosynthesis, PRPP + glutamine => IMP, organism-specific biosystem; Inosine monophosphate biosynthesis, PRPP + glutamine =>
Function (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate AMP-lyase (fumarate-forming) activity; N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity; NOT N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity; N6-(1,2-;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADSL Products

Required fields are marked with *

My Review for All ADSL Products

Required fields are marked with *

0
cart-icon
0
compare icon