"ALDH5A1" Related Products

Expand

Recombinant Human ALDH5A1, His-tagged

Cat.No.: ALDH5A1-26496TH
Product Overview: Recombinant fragment, corresponding to amino acids 109-535 of Human ALDH5A1 with an N terminal His tag. Observed mwt: 56 kDa ;
Description: This protein belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Brain, pancreas, heart, liver, skeletal muscle and kidney. Lower in placenta.
Form: Lyophilised:Reconstitute with 114 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FCRWREVSAKERSSLLRKWYNLMIQNKDDLARIITAESGK PLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDR RALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNA KEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKR VSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQ GPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKN FFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGL ISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGG L
Sequence Similarities: Belongs to the aldehyde dehydrogenase family.
Gene Name: ALDH5A1 aldehyde dehydrogenase 5 family, member A1 [ Homo sapiens ]
Official Symbol: ALDH5A1
Synonyms: ALDH5A1; aldehyde dehydrogenase 5 family, member A1; succinate-semialdehyde dehydrogenase, mitochondrial; SSADH; SSDH; succinate semialdehyde dehydrogenase;
Gene ID: 7915
mRNA Refseq: NM_001080
Protein Refseq: NP_001071
MIM: 610045
Uniprot ID: P51649
Chromosome Location: 6p22
Pathway: Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Degradation of GABA, organism-specific biosystem;
Function: oxidoreductase activity; protein homodimerization activity; succinate-semialdehyde dehydrogenase activity; succinate-semialdehyde dehydrogenase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.