Recombinant Human ALDH5A1 protein, His-tagged
| Cat.No. : | ALDH5A1-9562H |
| Product Overview : | Recombinant Human ALDH5A1 protein(175-535 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 175-535 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | YGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL |
| Gene Name | ALDH5A1 aldehyde dehydrogenase 5 family, member A1 [ Homo sapiens ] |
| Official Symbol | ALDH5A1 |
| Synonyms | ALDH5A1; aldehyde dehydrogenase 5 family, member A1; succinate-semialdehyde dehydrogenase, mitochondrial; SSADH; SSDH; succinate semialdehyde dehydrogenase; aldehyde dehydrogenase family 5 member A1; mitochondrial succinate semialdehyde dehydrogenase; NAD(+)-dependent succinic semialdehyde dehydrogenase; |
| Gene ID | 7915 |
| mRNA Refseq | NM_001080 |
| Protein Refseq | NP_001071 |
| MIM | 610045 |
| UniProt ID | P51649 |
| ◆ Recombinant Proteins | ||
| ALDH5A1-26496TH | Recombinant Human ALDH5A1, His-tagged | +Inquiry |
| ALDH5A1-1412HF | Recombinant Full Length Human ALDH5A1 Protein, GST-tagged | +Inquiry |
| ALDH5A1-450H | Recombinant Human ALDH5A1 Protein, GST-tagged | +Inquiry |
| ALDH5A1-6188Z | Recombinant Zebrafish ALDH5A1 | +Inquiry |
| ALDH5A1-2508H | Recombinant Human ALDH5A1 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ALDH5A1-60HCL | Recombinant Human ALDH5A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALDH5A1 Products
Required fields are marked with *
My Review for All ALDH5A1 Products
Required fields are marked with *
