Recombinant Human ALOX15

PRODUCTS

Home / Products / Antibody / Recombinant Human ALOX15

Recombinant Human ALOX15

ALOX15 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ALOX15-26020TH
Product Overview : Recombinant full length Human 15 Lipoxygenase 1 with N terminal proprietary tag; Predicted MWt 98.56 kDa.
Description : Arachidonate 15-lipoxygenase is an enzyme that in humans is encoded by the ALOX15 gene.
Protein length : 662 amino acids
Molecular Weight : 98.560kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLW PARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNW ISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDL PVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDL DDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQL PRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEIN VRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSS FCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVS LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQ ARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIR NAKLDMPYEYLRPSVVENSVAI
Sequence Similarities : Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.
Gene Name : ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens ]
Official Symbol : ALOX15
Synonyms : ALOX15; arachidonate 15-lipoxygenase; 15 LOX 1;
Gene ID : 246
mRNA Refseq : NM_001140
Protein Refseq : NP_001131
MIM : 152392
Uniprot ID : P16050
Chromosome Location : 17p13.3
Pathway : Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Linoleic acid metabolism, organism-specific biosystem;
Function : arachidonate 12-lipoxygenase activity; arachidonate 15-lipoxygenase activity; hepoxilin-epoxide hydrolase activity; iron ion binding; lipoxygenase activity;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.