"ALOX15" Related Products

Expand

Recombinant Human ALOX15

Cat.No.: ALOX15-26020TH
Product Overview: Recombinant full length Human 15 Lipoxygenase 1 with N terminal proprietary tag; Predicted MWt 98.56 kDa.
Description: Arachidonate 15-lipoxygenase is an enzyme that in humans is encoded by the ALOX15 gene.
Protein length: 662 amino acids
Molecular Weight: 98.560kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLW PARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNW ISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDL PVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDL DDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSL LDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQL PRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEIN VRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSS FCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVS LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQ ARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCT MRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIR NAKLDMPYEYLRPSVVENSVAI
Sequence Similarities: Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.
Gene Name: ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens ]
Official Symbol: ALOX15
Synonyms: ALOX15; arachidonate 15-lipoxygenase; 15 LOX 1;
Gene ID: 246
mRNA Refseq: NM_001140
Protein Refseq: NP_001131
MIM: 152392
Uniprot ID: P16050
Chromosome Location: 17p13.3
Pathway: Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; IL4-mediated signaling events, organism-specific biosystem; Linoleic acid metabolism, organism-specific biosystem;
Function: arachidonate 12-lipoxygenase activity; arachidonate 15-lipoxygenase activity; hepoxilin-epoxide hydrolase activity; iron ion binding; lipoxygenase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.