Recombinant Human ALOX15 Protein, GST-tagged
Cat.No. : | ALOX15-485H |
Product Overview : | Human ALOX15 full-length ORF ( AAH29032, 1 a.a. - 662 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ALOX15 (Arachidonate 15-Lipoxygenase) is a Protein Coding gene. Diseases associated with ALOX15 include Periventricular Leukomalacia and Artery Disease. Among its related pathways are Arachidonic acid metabolism and HETE and HPETE biosynthesis and metabolism. GO annotations related to this gene include iron ion binding and oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen. An important paralog of this gene is ALOX12. |
Molecular Mass : | 98.56 kDa |
AA Sequence : | MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens ] |
Official Symbol | ALOX15 |
Synonyms | ALOX15; arachidonate 15-lipoxygenase; 15 LOX 1; 15-LOX; 15-lipooxygenase-1; arachidonate omega-6 lipoxygenase; 15LOX-1; 15-LOX-1; |
Gene ID | 246 |
mRNA Refseq | NM_001140 |
Protein Refseq | NP_001131 |
MIM | 152392 |
UniProt ID | P16050 |
◆ Recombinant Proteins | ||
ALOX15-4696H | Recombinant Human ALOX15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALOX15-644HFL | Recombinant Full Length Human ALOX15 Protein, C-Flag-tagged | +Inquiry |
ALOX15-001H | Recombinant Human ALOX15 Protein, FLAG-tagged | +Inquiry |
ALOX15-485H | Recombinant Human ALOX15 Protein, GST-tagged | +Inquiry |
ALOX15-7892H | Recombinant Human ALOX15 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALOX15-8897HCL | Recombinant Human ALOX15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALOX15 Products
Required fields are marked with *
My Review for All ALOX15 Products
Required fields are marked with *
0
Inquiry Basket