Recombinant Human ALOX15 Protein, GST-tagged

Cat.No. : ALOX15-485H
Product Overview : Human ALOX15 full-length ORF ( AAH29032, 1 a.a. - 662 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ALOX15 (Arachidonate 15-Lipoxygenase) is a Protein Coding gene. Diseases associated with ALOX15 include Periventricular Leukomalacia and Artery Disease. Among its related pathways are Arachidonic acid metabolism and HETE and HPETE biosynthesis and metabolism. GO annotations related to this gene include iron ion binding and oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen. An important paralog of this gene is ALOX12.
Molecular Mass : 98.56 kDa
AA Sequence : MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPLLFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVVLRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPLVMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSHLLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMSTGGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYPQDALRLWEIIYRYVEGIVSLHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQPVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSVAI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALOX15 arachidonate 15-lipoxygenase [ Homo sapiens ]
Official Symbol ALOX15
Synonyms ALOX15; arachidonate 15-lipoxygenase; 15 LOX 1; 15-LOX; 15-lipooxygenase-1; arachidonate omega-6 lipoxygenase; 15LOX-1; 15-LOX-1;
Gene ID 246
mRNA Refseq NM_001140
Protein Refseq NP_001131
MIM 152392
UniProt ID P16050

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALOX15 Products

Required fields are marked with *

My Review for All ALOX15 Products

Required fields are marked with *

0
cart-icon