Recombinant Human APEH, His-tagged
Cat.No. : | APEH-26038TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 560-732 of Human AARE with an N terminal His tag. mol wt: 21 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 78 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQ YPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPF SSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQED RRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVE SDSFMNAVLWLRTHLGS |
Gene Name : | APEH N-acylaminoacyl-peptide hydrolase [ Homo sapiens ] |
Official Symbol : | APEH |
Synonyms : | APEH; N-acylaminoacyl-peptide hydrolase; D3F15S2, D3S48E, DNF15S2; acylamino-acid-releasing enzyme; |
Gene ID : | 327 |
mRNA Refseq : | NM_001640 |
Protein Refseq : | NP_001631 |
MIM : | 102645 |
Uniprot ID : | P13798 |
Chromosome Location : | 3p21 |
Function : | hydrolase activity; serine-type endopeptidase activity; |
Products Types
◆ Recombinant Protein | ||
APEH-181R | Recombinant Rhesus Macaque APEH Protein, His (Fc)-Avi-tagged | +Inquiry |
APEH-352R | Recombinant Rhesus monkey APEH Protein, His-tagged | +Inquiry |
APEH-676H | Recombinant Human APEH protein, GST-tagged | +Inquiry |
APEH-2527H | Recombinant Human APEH protein, His-tagged | +Inquiry |
Apeh-3142R | Recombinant Rat Apeh, His-tagged | +Inquiry |
◆ Lysates | ||
APEH-8798HCL | Recombinant Human APEH 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket