Recombinant Human APEH, His-tagged

Cat.No. : APEH-26038TH
Product Overview : Recombinant fragment, corresponding to amino acids 560-732 of Human AARE with an N terminal His tag. mol wt: 21 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 560-732 a.a.
Description : This gene encodes the enzyme acylpeptide hydrolase, which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. This gene is located within the same region of chromosome 3 (3p21) as the aminoacylase gene, and deletions at this locus are also associated with a decrease in aminoacylase activity. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 78 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VKDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQ YPETYRACVARNPVINIASMLGSTDIPDWCVVEAGFPF SSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQED RRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVE SDSFMNAVLWLRTHLGS
Gene Name APEH N-acylaminoacyl-peptide hydrolase [ Homo sapiens ]
Official Symbol APEH
Synonyms APEH; N-acylaminoacyl-peptide hydrolase; D3F15S2, D3S48E, DNF15S2; acylamino-acid-releasing enzyme;
Gene ID 327
mRNA Refseq NM_001640
Protein Refseq NP_001631
MIM 102645
Uniprot ID P13798
Chromosome Location 3p21
Function hydrolase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APEH Products

Required fields are marked with *

My Review for All APEH Products

Required fields are marked with *

0
cart-icon
0
compare icon