"ARL4D" Related Products

Expand
Expand

Recombinant Human ARL4D, His-tagged

Cat.No.: ARL4D-27056TH
Product Overview: Recombinant full length Human ARF4L with N terminal His tag; 221 amino acids with tag, Predicted MWt 24.3 kDa.
Description: ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS).
Protein length: 201 amino acids
Conjugation: HIS
Molecular Weight: 24.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 1.17% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGNHLTEMAPTASSFLPHFQ ALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTE KIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLV FVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANK QDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGL QQGLERLYEMILKRKKAARGGKKRR
Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.
Gene Name: ARL4D ADP-ribosylation factor-like 4D [ Homo sapiens ]
Official Symbol: ARL4D
Synonyms: ARL4D; ADP-ribosylation factor-like 4D; ADP ribosylation factor 4 like , ARF4L; ADP-ribosylation factor-like protein 4D;
Gene ID: 379
mRNA Refseq: NM_001661
Protein Refseq: NP_001652
MIM: 600732
Uniprot ID: P49703
Chromosome Location: 17q12-q21
Function: GTP binding; GTPase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.