Recombinant Human ARL4D, His-tagged
Cat.No. : | ARL4D-27056TH |
Product Overview : | Recombinant full length Human ARF4L with N terminal His tag; 221 amino acids with tag, Predicted MWt 24.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 201 amino acids |
Description : | ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). |
Conjugation : | HIS |
Molecular Weight : | 24.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 1.17% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGNHLTEMAPTASSFLPHFQ ALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTE KIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLV FVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANK QDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGL QQGLERLYEMILKRKKAARGGKKRR |
Sequence Similarities : | Belongs to the small GTPase superfamily. Arf family. |
Gene Name | ARL4D ADP-ribosylation factor-like 4D [ Homo sapiens ] |
Official Symbol | ARL4D |
Synonyms | ARL4D; ADP-ribosylation factor-like 4D; ADP ribosylation factor 4 like , ARF4L; ADP-ribosylation factor-like protein 4D; |
Gene ID | 379 |
mRNA Refseq | NM_001661 |
Protein Refseq | NP_001652 |
MIM | 600732 |
Uniprot ID | P49703 |
Chromosome Location | 17q12-q21 |
Function | GTP binding; GTPase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
ARL4D-1933M | Recombinant Mouse ARL4D Protein | +Inquiry |
ARF4L-747H | Recombinant Human ARF4L protein, GST-tagged | +Inquiry |
ARL4D-231R | Recombinant Rhesus Macaque ARL4D Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL4D-402R | Recombinant Rhesus monkey ARL4D Protein, His-tagged | +Inquiry |
ARL4D-1182HF | Recombinant Full Length Human ARL4D Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL4D-8711HCL | Recombinant Human ARL4D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL4D Products
Required fields are marked with *
My Review for All ARL4D Products
Required fields are marked with *
0
Inquiry Basket