"ARL4D" Related Products

Expand
Expand

Recombinant Human ARL4D, His-tagged

Cat.No.: ARL4D-27056TH
Product Overview: Recombinant full length Human ARF4L with N terminal His tag; 221 amino acids with tag, Predicted MWt 24.3 kDa.
Description: ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS).
Protein length: 201 amino acids
Conjugation: HIS
Molecular Weight: 24.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 1.17% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGNHLTEMAPTASSFLPHFQ ALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTE KIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLV FVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANK QDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGL QQGLERLYEMILKRKKAARGGKKRR
Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.
Gene Name: ARL4D ADP-ribosylation factor-like 4D [ Homo sapiens ]
Official Symbol: ARL4D
Synonyms: ARL4D; ADP-ribosylation factor-like 4D; ADP ribosylation factor 4 like , ARF4L; ADP-ribosylation factor-like protein 4D;
Gene ID: 379
mRNA Refseq: NM_001661
Protein Refseq: NP_001652
MIM: 600732
Uniprot ID: P49703
Chromosome Location: 17q12-q21
Function: GTP binding; GTPase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.