Recombinant Human ARL4D protein, GST-tagged
Cat.No. : | ARL4D-813H |
Product Overview : | Human ARL4D full-length ORF ( NP_001652.2, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). [provided by RefSeq, Jul 2008] |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL4D ADP-ribosylation factor-like 4D [ Homo sapiens ] |
Official Symbol | ARL4D |
Synonyms | ARL4D; ADP-ribosylation factor-like 4D; ADP ribosylation factor 4 like , ARF4L; ADP-ribosylation factor-like protein 4D; ADP-ribosylation factor-like 6; ADP-ribosylation factor-like protein 4L; ARL6; ARF4L; |
Gene ID | 379 |
mRNA Refseq | NM_001661 |
Protein Refseq | NP_001652 |
MIM | 600732 |
UniProt ID | P49703 |
◆ Recombinant Proteins | ||
ARL4D-813H | Recombinant Human ARL4D protein, GST-tagged | +Inquiry |
ARL4D-6889H | Recombinant Human ADP-Ribosylation Factor-Like 4D, His-tagged | +Inquiry |
ARL4D-724M | Recombinant Mouse ARL4D Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL4D-402R | Recombinant Rhesus monkey ARL4D Protein, His-tagged | +Inquiry |
ARL4D-10045Z | Recombinant Zebrafish ARL4D | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL4D-8711HCL | Recombinant Human ARL4D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL4D Products
Required fields are marked with *
My Review for All ARL4D Products
Required fields are marked with *
0
Inquiry Basket