Recombinant Human ARRB1

• Cat.No.: ARRB1-26620TH
• Product Overview: Recombinant fragment corresponding to amino acids 13-122 of Human beta Arrestin 1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Description: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERR VYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE DKKPLTRLQERLIKKLGEHAYPFTFEIPPN
• Sequence Similarities: Belongs to the arrestin family.

Gene Information

• Gene Name: ARRB1 arrestin, beta 1 [ Homo sapiens ]
• Official Symbol: ARRB1
• Synonyms: ARRB1; arrestin, beta 1; ARR1; beta-arrestin-1; arrestin 2
• Gene ID: 408
• mRNA Refseq: NM_004041
• Protein Refseq: NP_004032
• MIM: 107940
• Uniprot ID: P49407
• Chromosome Location: 11q13
• Pathway: CXCR3-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem
• Function: GTPase activator activity; angiotensin receptor binding; enzyme inhibitor activity; NOT histone acetyltransferase activity; insulin-like growth factor receptor binding