"ARRB1" Related Products

Expand
Expand
Expand

Recombinant Human ARRB1

Cat.No.: ARRB1-26620TH
Product Overview: Recombinant fragment corresponding to amino acids 13-122 of Human beta Arrestin 1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
Description: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERR VYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE DKKPLTRLQERLIKKLGEHAYPFTFEIPPN
Sequence Similarities: Belongs to the arrestin family.
Gene Name: ARRB1 arrestin, beta 1 [ Homo sapiens ]
Official Symbol: ARRB1
Synonyms: ARRB1; arrestin, beta 1; ARR1; beta-arrestin-1; arrestin 2;
Gene ID: 408
mRNA Refseq: NM_004041
Protein Refseq: NP_004032
MIM: 107940
Uniprot ID: P49407
Chromosome Location: 11q13
Pathway: CXCR3-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem;
Function: GTPase activator activity; angiotensin receptor binding; enzyme inhibitor activity; NOT histone acetyltransferase activity; insulin-like growth factor receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.