Recombinant Human ARRB1

Cat.No. : ARRB1-26620TH
Product Overview : Recombinant fragment corresponding to amino acids 13-122 of Human beta Arrestin 1 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERR VYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPE DKKPLTRLQERLIKKLGEHAYPFTFEIPPN
Sequence Similarities : Belongs to the arrestin family.
Gene Name ARRB1 arrestin, beta 1 [ Homo sapiens ]
Official Symbol ARRB1
Synonyms ARRB1; arrestin, beta 1; ARR1; beta-arrestin-1; arrestin 2;
Gene ID 408
mRNA Refseq NM_004041
Protein Refseq NP_004032
MIM 107940
Uniprot ID P49407
Chromosome Location 11q13
Pathway CXCR3-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem;
Function GTPase activator activity; angiotensin receptor binding; enzyme inhibitor activity; NOT histone acetyltransferase activity; insulin-like growth factor receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARRB1 Products

Required fields are marked with *

My Review for All ARRB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon