"ARRB2" Related Products

Expand
Expand

Recombinant Human ARRB2

Cat.No.: ARRB2-26621TH
Product Overview: Recombinant fragment corresponding to amino acids 300-409 of Human Beta Arrestin 2 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
Description: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVE LPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTN YATDDDIVFEDFARLRLKGMKDDDYDDQLC
Sequence Similarities: Belongs to the arrestin family.
Gene Name: ARRB2 arrestin, beta 2 [ Homo sapiens ]
Official Symbol: ARRB2
Synonyms: ARRB2; arrestin, beta 2; ARR2; beta-arrestin-2; arrestin 3; BARR2; DKFZp686L0365;
Gene ID: 409
mRNA Refseq: NM_004313
Protein Refseq: NP_004304
MIM: 107941
Uniprot ID: P32121
Chromosome Location: 17p13
Pathway: ALK1 signaling events, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Atypical NF-kappaB pathway, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem;
Function: G-protein coupled receptor binding; angiotensin receptor binding; protein binding; protein kinase B binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.