Recombinant Human ARRB2

Cat.No. : ARRB2-26621TH
Product Overview : Recombinant fragment corresponding to amino acids 300-409 of Human Beta Arrestin 2 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVE LPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTN YATDDDIVFEDFARLRLKGMKDDDYDDQLC
Sequence Similarities : Belongs to the arrestin family.
Gene Name ARRB2 arrestin, beta 2 [ Homo sapiens ]
Official Symbol ARRB2
Synonyms ARRB2; arrestin, beta 2; ARR2; beta-arrestin-2; arrestin 3; BARR2; DKFZp686L0365;
Gene ID 409
mRNA Refseq NM_004313
Protein Refseq NP_004304
MIM 107941
Uniprot ID P32121
Chromosome Location 17p13
Pathway ALK1 signaling events, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Atypical NF-kappaB pathway, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem;
Function G-protein coupled receptor binding; angiotensin receptor binding; protein binding; protein kinase B binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARRB2 Products

Required fields are marked with *

My Review for All ARRB2 Products

Required fields are marked with *

0
cart-icon