Recombinant Human ARRB2
Cat.No. : | ARRB2-26621TH |
Product Overview : | Recombinant fragment corresponding to amino acids 300-409 of Human Beta Arrestin 2 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVE LPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTN YATDDDIVFEDFARLRLKGMKDDDYDDQLC |
Sequence Similarities : | Belongs to the arrestin family. |
Gene Name | ARRB2 arrestin, beta 2 [ Homo sapiens ] |
Official Symbol | ARRB2 |
Synonyms | ARRB2; arrestin, beta 2; ARR2; beta-arrestin-2; arrestin 3; BARR2; DKFZp686L0365; |
Gene ID | 409 |
mRNA Refseq | NM_004313 |
Protein Refseq | NP_004304 |
MIM | 107941 |
Uniprot ID | P32121 |
Chromosome Location | 17p13 |
Pathway | ALK1 signaling events, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Atypical NF-kappaB pathway, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; |
Function | G-protein coupled receptor binding; angiotensin receptor binding; protein binding; protein kinase B binding; receptor binding; |
◆ Recombinant Proteins | ||
ARRB2-0341H | Recombinant Human ARRB2 Protein, Tag Free | +Inquiry |
ARRB2-1247HF | Recombinant Full Length Human ARRB2 Protein, GST-tagged | +Inquiry |
ARRb2-3639H | Recombinant Human ARRb2 protein(Asp262~Cys430), His-GST-tagged | +Inquiry |
ARRB2-803R | Recombinant Rat ARRB2 Protein | +Inquiry |
ARRB2-0340H | Recombinant Human ARRB2 Protein (Met1-Cys409), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRB2-130HCL | Recombinant Human ARRB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARRB2 Products
Required fields are marked with *
My Review for All ARRB2 Products
Required fields are marked with *