Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ARRB2

Cat.No. : ARRB2-26621TH
Product Overview : Recombinant fragment corresponding to amino acids 300-409 of Human Beta Arrestin 2 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVE LPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTN YATDDDIVFEDFARLRLKGMKDDDYDDQLC
Sequence Similarities : Belongs to the arrestin family.
Gene Name : ARRB2 arrestin, beta 2 [ Homo sapiens ]
Official Symbol : ARRB2
Synonyms : ARRB2; arrestin, beta 2; ARR2; beta-arrestin-2; arrestin 3; BARR2; DKFZp686L0365;
Gene ID : 409
mRNA Refseq : NM_004313
Protein Refseq : NP_004304
MIM : 107941
Uniprot ID : P32121
Chromosome Location : 17p13
Pathway : ALK1 signaling events, organism-specific biosystem; Arf6 signaling events, organism-specific biosystem; Atypical NF-kappaB pathway, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem;
Function : G-protein coupled receptor binding; angiotensin receptor binding; protein binding; protein kinase B binding; receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends