Recombinant Human ATF6B
| Cat.No. : | ATF6B-26189TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 2-88 of Human ATF6 beta, with an N-terminal proprietary tag, predicted MWt 35.2 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 87 amino acids |
| Description : | The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 35.200kDa inclusive of tags |
| Tissue specificity : | Ubiquitous. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK |
| Sequence Similarities : | Belongs to the bZIP family. ATF subfamily.Contains 1 bZIP domain. |
| Gene Name | ATF6B activating transcription factor 6 beta [ Homo sapiens ] |
| Official Symbol | ATF6B |
| Synonyms | ATF6B; activating transcription factor 6 beta; cAMP responsive element binding protein like 1 , CREBL1; cyclic AMP-dependent transcription factor ATF-6 beta; G13; |
| Gene ID | 1388 |
| mRNA Refseq | NM_001136153 |
| Protein Refseq | NP_001129625 |
| MIM | 600984 |
| Uniprot ID | Q99941 |
| Chromosome Location | 6p21.3 |
| Pathway | Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; G1 to S cell cycle control, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; |
| Function | protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| ATF6B-4821Z | Recombinant Zebrafish ATF6B | +Inquiry |
| RFL-9388MF | Recombinant Full Length Mouse Cyclic Amp-Dependent Transcription Factor Atf-6 Beta(Atf6B) Protein, His-Tagged | +Inquiry |
| ATF6B-1520HF | Recombinant Full Length Human ATF6B Protein, GST-tagged | +Inquiry |
| ATF6B-26100TH | Recombinant Human ATF6B Protein, GST-tagged | +Inquiry |
| ATF6B-2070M | Recombinant Mouse ATF6B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATF6B Products
Required fields are marked with *
My Review for All ATF6B Products
Required fields are marked with *
