Recombinant Human ATG4B, His-tagged
Cat.No. : | ATG4B-26192TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-393 of Human ATG4B with N terminal His tag, 58kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-393 a.a. |
Description : | Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Conjugation : | HIS |
Tissue specificity : | Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas. |
Form : | Lyophilised:Reconstitute with 65 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKD EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRC GQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLA VFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATA FPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGE ELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSI AELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDF EILSL |
Sequence Similarities : | Belongs to the peptidase C54 family. |
Full Length : | Full L. |
Gene Name | ATG4B ATG4 autophagy related 4 homolog B (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG4B |
Synonyms | ATG4B; ATG4 autophagy related 4 homolog B (S. cerevisiae); APG4 autophagy 4 homolog B (S. cerevisiae) , APG4B; cysteine protease ATG4B; Apg4B; AUTL1; DKFZp586D1822; KIAA0943; |
Gene ID | 23192 |
mRNA Refseq | NM_013325 |
Protein Refseq | NP_037457 |
MIM | 611338 |
Uniprot ID | Q9Y4P1 |
Chromosome Location | 2q37.3 |
Pathway | Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem; |
Function | cysteine-type peptidase activity; peptidase activity; protein binding; |
◆ Recombinant Proteins | ||
ATG4B-26192TH | Recombinant Human ATG4B, His-tagged | +Inquiry |
ATG4B-7126C | Recombinant Chicken ATG4B | +Inquiry |
ATG4B-9975H | Recombinant Human ATG4B, GST-tagged | +Inquiry |
ATG4B-5507Z | Recombinant Zebrafish ATG4B | +Inquiry |
ATG4B-4355H | Recombinant Human ATG4B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG4B-8624HCL | Recombinant Human ATG4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG4B Products
Required fields are marked with *
My Review for All ATG4B Products
Required fields are marked with *
0
Inquiry Basket