Recombinant Human ATG4B, His-tagged

Cat.No. : ATG4B-26192TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-393 of Human ATG4B with N terminal His tag, 58kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-393 a.a.
Description : Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Conjugation : HIS
Tissue specificity : Mainly expressed in the skeletal muscle, followed by brain, heart, liver and pancreas.
Form : Lyophilised:Reconstitute with 65 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKD EILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRC GQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLA VFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATA FPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGE ELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSI AELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDF EILSL
Sequence Similarities : Belongs to the peptidase C54 family.
Full Length : Full L.
Gene Name ATG4B ATG4 autophagy related 4 homolog B (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG4B
Synonyms ATG4B; ATG4 autophagy related 4 homolog B (S. cerevisiae); APG4 autophagy 4 homolog B (S. cerevisiae) , APG4B; cysteine protease ATG4B; Apg4B; AUTL1; DKFZp586D1822; KIAA0943;
Gene ID 23192
mRNA Refseq NM_013325
Protein Refseq NP_037457
MIM 611338
Uniprot ID Q9Y4P1
Chromosome Location 2q37.3
Pathway Regulation of autophagy, organism-specific biosystem; Regulation of autophagy, conserved biosystem;
Function cysteine-type peptidase activity; peptidase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG4B Products

Required fields are marked with *

My Review for All ATG4B Products

Required fields are marked with *

0
cart-icon