Recombinant Human ATP2A3

• Cat.No.: ATP2A3-31352TH
• Product Overview: Recombinant fragment of Human SERCA3 ATPase with N terminal proprietary tag. Predicted MW 38.83 kDa.

Specification

• Description: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Protein length: 120 amino acids
• Molecular Weight: 38.830kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPT SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDD CSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
• Sequence Similarities: Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily.

Gene Information

• Gene Name: ATP2A3 ATPase, Ca++ transporting, ubiquitous [ Homo sapiens ]
• Official Symbol: ATP2A3
• Synonyms: ATP2A3; ATPase, Ca++ transporting, ubiquitous; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3
• Gene ID: 489
• mRNA Refseq: NM_005173
• Protein Refseq: NP_005164
• MIM: 601929
• Uniprot ID: Q93084
• Chromosome Location: 17p13.3
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem
• Function: ATP binding; calcium-transporting ATPase activity; hydrolase activity; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; metal ion binding