Recombinant Human ATP2A3
Cat.No. : | ATP2A3-31352TH |
Product Overview : | Recombinant fragment of Human SERCA3 ATPase with N terminal proprietary tag. Predicted MW 38.83 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 120 amino acids |
Description : | This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Weight : | 38.830kDa inclusive of tags |
Tissue specificity : | Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPT SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDD CSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR |
Sequence Similarities : | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. |
Gene Name | ATP2A3 ATPase, Ca++ transporting, ubiquitous [ Homo sapiens ] |
Official Symbol | ATP2A3 |
Synonyms | ATP2A3; ATPase, Ca++ transporting, ubiquitous; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3; |
Gene ID | 489 |
mRNA Refseq | NM_005173 |
Protein Refseq | NP_005164 |
MIM | 601929 |
Uniprot ID | Q93084 |
Chromosome Location | 17p13.3 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; |
Function | ATP binding; calcium-transporting ATPase activity; hydrolase activity; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; metal ion binding; |
◆ Recombinant Proteins | ||
ATP2A3-860R | Recombinant Rat ATP2A3 Protein | +Inquiry |
ATP2A3-2783H | Recombinant Human ATP2A3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Atp2a3-1766M | Recombinant Mouse Atp2a3 Protein, Myc/DDK-tagged | +Inquiry |
ATP2A3-1885HFL | Recombinant Full Length Human ATP2A3 Protein, C-Flag-tagged | +Inquiry |
ATP2A3-10011H | Recombinant Human ATP2A3, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP2A3 Products
Required fields are marked with *
My Review for All ATP2A3 Products
Required fields are marked with *