Recombinant Human ATP2A3

Cat.No. : ATP2A3-31352TH
Product Overview : Recombinant fragment of Human SERCA3 ATPase with N terminal proprietary tag. Predicted MW 38.83 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 120 amino acids
Description : This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight : 38.830kDa inclusive of tags
Tissue specificity : Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPT SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDD CSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
Sequence Similarities : Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily.
Gene Name ATP2A3 ATPase, Ca++ transporting, ubiquitous [ Homo sapiens ]
Official Symbol ATP2A3
Synonyms ATP2A3; ATPase, Ca++ transporting, ubiquitous; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3;
Gene ID 489
mRNA Refseq NM_005173
Protein Refseq NP_005164
MIM 601929
Uniprot ID Q93084
Chromosome Location 17p13.3
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem;
Function ATP binding; calcium-transporting ATPase activity; hydrolase activity; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP2A3 Products

Required fields are marked with *

My Review for All ATP2A3 Products

Required fields are marked with *

0
cart-icon