Cat.No. : |
ATP7A-27417TH |
Product Overview : |
Recombinant fragment corresponding to amino acids 1406-1500 of Human ATP7A with an N terminal proprietary tag; Predicted MWt 36.08 kDa. |
Description : |
This gene encodes a transmembrane protein that functions in copper transport across membranes. This protein is localized to the trans-Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. It relocalizes to the plasma membrane under conditions of elevated extracellular copper, and functions in the efflux of copper from cells. Mutations in this gene are associated with Menkes disease, X-linked cutis laxa, and occipital horn syndrome. |
Protein length : |
95 amino acids |
Molecular Weight : |
36.080kDa inclusive of tags |
Source : |
Wheat germ |
Tissue specificity : |
Found in most tissues except liver. Isoform 3 is widely expressed including in liver cell lines. Isoform 1 is expressed in fibroblasts, choriocarcinoma, colon carcinoma and neuroblastoma cell lines. Isoform 2 is expressed in fibroblasts, colon carcinoma a |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL |
Sequence Similarities : |
Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IB subfamily.Contains 6 HMA domains. |