Recombinant Human BACH1 BACH1-27427TH

Recombinant Human BACH1

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BACH1

Recombinant Human BACH1

BACH1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BACH1-27427TH
Product Overview : Recombinant fragment of Human BACH1.3 with N terminal proprietary tag. Predicted MW 37.51 kDa.
Description : This gene encodes a transcription factor that belongs to the capncollar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene.
Protein length : 108 amino acids
Molecular Weight : 37.510kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEK DKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARG QESQQMSTATSEQAGPAEQCRQSGGISD
Sequence Similarities : Belongs to the bZIP family. CNC subfamily.Contains 1 BTB (POZ) domain.Contains 1 bZIP domain.
Gene Name : BACH1 BTB and CNC homology 1, basic leucine zipper transcription factor 1 [ Homo sapiens ]
Official Symbol : BACH1
Synonyms : BACH1; BTB and CNC homology 1, basic leucine zipper transcription factor 1; transcription regulator protein BACH1; BACH 1;
Gene ID : 571
mRNA Refseq : NM_001186
Protein Refseq : NP_001177
MIM : 602751
Uniprot ID : O14867
Chromosome Location : 21q22.1
Function : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy