Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human BACH1

Cat.No. : BACH1-27427TH
Product Overview : Recombinant fragment of Human BACH1.3 with N terminal proprietary tag. Predicted MW 37.51 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a transcription factor that belongs to the capncollar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene.
Protein length : 108 amino acids
Molecular Weight : 37.510kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEK DKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARG QESQQMSTATSEQAGPAEQCRQSGGISD
Sequence Similarities : Belongs to the bZIP family. CNC subfamily.Contains 1 BTB (POZ) domain.Contains 1 bZIP domain.
Gene Name : BACH1 BTB and CNC homology 1, basic leucine zipper transcription factor 1 [ Homo sapiens ]
Official Symbol : BACH1
Synonyms : BACH1; BTB and CNC homology 1, basic leucine zipper transcription factor 1; transcription regulator protein BACH1; BACH 1;
Gene ID : 571
mRNA Refseq : NM_001186
Protein Refseq : NP_001177
MIM : 602751
Uniprot ID : O14867
Chromosome Location : 21q22.1
Function : RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends