Recombinant Human BACH1

Cat.No. : BACH1-27427TH
Product Overview : Recombinant fragment of Human BACH1.3 with N terminal proprietary tag. Predicted MW 37.51 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 108 amino acids
Description : This gene encodes a transcription factor that belongs to the capncollar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene.
Molecular Weight : 37.510kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEK DKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARG QESQQMSTATSEQAGPAEQCRQSGGISD
Sequence Similarities : Belongs to the bZIP family. CNC subfamily.Contains 1 BTB (POZ) domain.Contains 1 bZIP domain.
Gene Name BACH1 BTB and CNC homology 1, basic leucine zipper transcription factor 1 [ Homo sapiens ]
Official Symbol BACH1
Synonyms BACH1; BTB and CNC homology 1, basic leucine zipper transcription factor 1; transcription regulator protein BACH1; BACH 1;
Gene ID 571
mRNA Refseq NM_001186
Protein Refseq NP_001177
MIM 602751
Uniprot ID O14867
Chromosome Location 21q22.1
Function RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BACH1 Products

Required fields are marked with *

My Review for All BACH1 Products

Required fields are marked with *

0
cart-icon