Recombinant Human BACH1

• Cat.No.: BACH1-27427TH
• Product Overview: Recombinant fragment of Human BACH1.3 with N terminal proprietary tag. Predicted MW 37.51 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 108 amino acids
• Description: This gene encodes a transcription factor that belongs to the capncollar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene.
• Molecular Weight: 37.510kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEK DKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARG QESQQMSTATSEQAGPAEQCRQSGGISD
• Sequence Similarities: Belongs to the bZIP family. CNC subfamily.Contains 1 BTB (POZ) domain.Contains 1 bZIP domain.

Gene Information

• Gene Name: BACH1 BTB and CNC homology 1, basic leucine zipper transcription factor 1 [ Homo sapiens ]
• Official Symbol: BACH1
• Synonyms: BACH1; BTB and CNC homology 1, basic leucine zipper transcription factor 1; transcription regulator protein BACH1; BACH 1
• Gene ID: 571
• mRNA Refseq: NM_001186
• Protein Refseq: NP_001177
• MIM: 602751
• Uniprot ID: O14867
• Chromosome Location: 21q22.1
• Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto