Recombinant Human BACH1
Cat.No. : | BACH1-27427TH |
Product Overview : | Recombinant fragment of Human BACH1.3 with N terminal proprietary tag. Predicted MW 37.51 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 108 amino acids |
Description : | This gene encodes a transcription factor that belongs to the capncollar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. |
Molecular Weight : | 37.510kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NLTGLCQKVCKEAALSQEQIQILAKYSAADCPLSFLISEK DKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARG QESQQMSTATSEQAGPAEQCRQSGGISD |
Sequence Similarities : | Belongs to the bZIP family. CNC subfamily.Contains 1 BTB (POZ) domain.Contains 1 bZIP domain. |
Gene Name | BACH1 BTB and CNC homology 1, basic leucine zipper transcription factor 1 [ Homo sapiens ] |
Official Symbol | BACH1 |
Synonyms | BACH1; BTB and CNC homology 1, basic leucine zipper transcription factor 1; transcription regulator protein BACH1; BACH 1; |
Gene ID | 571 |
mRNA Refseq | NM_001186 |
Protein Refseq | NP_001177 |
MIM | 602751 |
Uniprot ID | O14867 |
Chromosome Location | 21q22.1 |
Function | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription facto |
◆ Recombinant Proteins | ||
BACH1-22H | Recombinant Human BACH1 Protein, MYC/DDK-tagged | +Inquiry |
BACH1-4068H | Recombinant Human BACH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BACH1-332R | Recombinant Rhesus Macaque BACH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BACH1-254HFL | Recombinant Full Length Human BACH1 Protein, C-Flag-tagged | +Inquiry |
BACH1-044H | Recombinant Human BACH1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BACH1-8531HCL | Recombinant Human BACH1 293 Cell Lysate | +Inquiry |
BACH1-8532HCL | Recombinant Human BACH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BACH1 Products
Required fields are marked with *
My Review for All BACH1 Products
Required fields are marked with *