Recombinant Human BARD1

• Cat.No.: BARD1-26645TH
• Product Overview: Recombinant fragment, corresponding to amino acids 658-757 of Human BARD1, with an N-terminal proprietary tag, predicted MWt 36.63 kDa

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK
• Sequence Similarities: Contains 4 ANK repeats.Contains 2 BRCT domains.Contains 1 RING-type zinc finger.

Gene Information

• Gene Name: BARD1 BRCA1 associated RING domain 1 [ Homo sapiens ]
• Official Symbol: BARD1
• Synonyms: BARD1; BRCA1 associated RING domain 1; BRCA1-associated RING domain protein 1
• Gene ID: 580
• mRNA Refseq: NM_000465
• Protein Refseq: NP_000456
• MIM: 601593
• Uniprot ID: Q99728
• Chromosome Location: 2q34-q35
• Pathway: BARD1 signaling events, organism-specific biosystem
• Function: RNA binding; kinase binding; ligase activity; metal ion binding; protein binding