Recombinant Human BARD1 BARD1-26645TH

Specification
Gene Information
Related Products

Cat.No.:	BARD1-26645TH
Product Overview:	Recombinant fragment, corresponding to amino acids 658-757 of Human BARD1, with an N-terminal proprietary tag, predicted MWt 36.63 kDa
Description:	This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer.
Protein length:	100 amino acids
Molecular Weight:	36.630kDa inclusive of tags
Source:	Wheat germ
Form:	Liquid
Purity:	Proprietary Purification
Storage buffer:	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:	RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK
Sequence Similarities:	Contains 4 ANK repeats.Contains 2 BRCT domains.Contains 1 RING-type zinc finger.

Download Datasheet

Gene Name:	BARD1 BRCA1 associated RING domain 1 [ Homo sapiens ]
Official Symbol:	BARD1
Synonyms:	BARD1; BRCA1 associated RING domain 1; BRCA1-associated RING domain protein 1;
Gene ID:	580
mRNA Refseq:	NM_000465
Protein Refseq:	NP_000456
MIM:	601593
Uniprot ID:	Q99728
Chromosome Location:	2q34-q35
Pathway:	BARD1 signaling events, organism-specific biosystem;
Function:	RNA binding; kinase binding; ligase activity; metal ion binding; protein binding;