Recombinant Human BARD1
Cat.No. : | BARD1-26645TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 658-757 of Human BARD1, with an N-terminal proprietary tag, predicted MWt 36.63 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK |
Sequence Similarities : | Contains 4 ANK repeats.Contains 2 BRCT domains.Contains 1 RING-type zinc finger. |
Gene Name | BARD1 BRCA1 associated RING domain 1 [ Homo sapiens ] |
Official Symbol | BARD1 |
Synonyms | BARD1; BRCA1 associated RING domain 1; BRCA1-associated RING domain protein 1; |
Gene ID | 580 |
mRNA Refseq | NM_000465 |
Protein Refseq | NP_000456 |
MIM | 601593 |
Uniprot ID | Q99728 |
Chromosome Location | 2q34-q35 |
Pathway | BARD1 signaling events, organism-specific biosystem; |
Function | RNA binding; kinase binding; ligase activity; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
BARD1-228H | Recombinant Human BARD1 protein, His-tagged | +Inquiry |
BARD1-03HF | Recombinant Full Length Human BARD1 Protein, Fc tagged | +Inquiry |
BARD1-1816HF | Recombinant Full Length Human BARD1 Protein, GST-tagged | +Inquiry |
BARD1-2291M | Recombinant Mouse BARD1 Protein | +Inquiry |
BARD1-598R | Recombinant Rat BARD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BARD1 Products
Required fields are marked with *
My Review for All BARD1 Products
Required fields are marked with *
0
Inquiry Basket