Recombinant Human BARD1

Cat.No. : BARD1-26645TH
Product Overview : Recombinant fragment, corresponding to amino acids 658-757 of Human BARD1, with an N-terminal proprietary tag, predicted MWt 36.63 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a protein which interacts with the N-terminal region of BRCA1. In addition to its ability to bind BRCA1 in vivo and in vitro, it shares homology with the 2 most conserved regions of BRCA1: the N-terminal RING motif and the C-terminal BRCT domain. The RING motif is a cysteine-rich sequence found in a variety of proteins that regulate cell growth, including the products of tumor suppressor genes and dominant protooncogenes. This protein also contains 3 tandem ankyrin repeats. The BARD1/BRCA1 interaction is disrupted by tumorigenic amino acid substitutions in BRCA1, implying that the formation of a stable complex between these proteins may be an essential aspect of BRCA1 tumor suppression. This protein may be the target of oncogenic mutations in breast or ovarian cancer.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RRSRLNREQLLPKLFDGCYFYLWGTFKHHPKDNLIKLVTAGGGQILSRKPKPDSDVTQTINTVAYHARPDSDQRFCTQYIIYEDLCNYHPERVRQGKVWK
Sequence Similarities : Contains 4 ANK repeats.Contains 2 BRCT domains.Contains 1 RING-type zinc finger.
Gene Name BARD1 BRCA1 associated RING domain 1 [ Homo sapiens ]
Official Symbol BARD1
Synonyms BARD1; BRCA1 associated RING domain 1; BRCA1-associated RING domain protein 1;
Gene ID 580
mRNA Refseq NM_000465
Protein Refseq NP_000456
MIM 601593
Uniprot ID Q99728
Chromosome Location 2q34-q35
Pathway BARD1 signaling events, organism-specific biosystem;
Function RNA binding; kinase binding; ligase activity; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BARD1 Products

Required fields are marked with *

My Review for All BARD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon