Recombinant Human BCL2L11 protein, GST-tagged

Cat.No. : BCL2L11-26430TH
Product Overview : Recombinant Human BCL2L11(1 a.a. - 112 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Availability January 30, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-112 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 38.8 kDa
AA Sequence : MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIL EDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ]
Official Symbol BCL2L11
Synonyms BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6;
Gene ID 10018
mRNA Refseq NM_207002
Protein Refseq NP_996885
MIM 603827
UniProt ID O43521
Chromosome Location 2q13
Pathway Activation of BH3-only proteins, organism-specific biosystem; Activation of BIM and translocation to mitochondria, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem;
Function contributes_to microtubule binding; microtubule binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCL2L11 Products

Required fields are marked with *

My Review for All BCL2L11 Products

Required fields are marked with *

0
cart-icon
0
compare icon