Recombinant Human BCL2L11 protein, GST-tagged
| Cat.No. : | BCL2L11-26430TH |
| Product Overview : | Recombinant Human BCL2L11(1 a.a. - 112 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
| Availability | January 07, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-112 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 38.8 kDa |
| AA Sequence : | MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIL EDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ] |
| Official Symbol | BCL2L11 |
| Synonyms | BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6; |
| Gene ID | 10018 |
| mRNA Refseq | NM_207002 |
| Protein Refseq | NP_996885 |
| MIM | 603827 |
| UniProt ID | O43521 |
| Chromosome Location | 2q13 |
| Pathway | Activation of BH3-only proteins, organism-specific biosystem; Activation of BIM and translocation to mitochondria, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem; |
| Function | contributes_to microtubule binding; microtubule binding; protein binding; |
| ◆ Recombinant Proteins | ||
| BCL2L11-1525H | Recombinant Human BCL2L11 protein, His-tagged | +Inquiry |
| BCL2L11-133H | Recombinant Human BCL2L11 protein(Ala2-Arg120), His-tagged | +Inquiry |
| BCL2L11-3454H | Recombinant Human BCL2L11 protein, His-tagged | +Inquiry |
| BCL2L11-1578H | Recombinant Human BCL2-Like 11 (Apoptosis Facilitator) | +Inquiry |
| BCL2L11-618R | Recombinant Rat BCL2L11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCL2L11-60HCL | Recombinant Human BCL2L11 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCL2L11 Products
Required fields are marked with *
My Review for All BCL2L11 Products
Required fields are marked with *
