Recombinant Human BCL2L11 protein, GST-tagged BCL2L11-26430TH

Recombinant Human BCL2L11 protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BCL2L11 protein, GST-tagged

Recombinant Human BCL2L11 protein, GST-tagged

BCL2L11 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BCL2L11-26430TH
Product Overview : Recombinant Human BCL2L11(1 a.a. - 112 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 38.8 kDa
AA Sequence : MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIL EDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ]
Official Symbol : BCL2L11
Synonyms : BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6;
Gene ID : 10018
mRNA Refseq : NM_207002
Protein Refseq : NP_996885
MIM : 603827
UniProt ID : O43521
Chromosome Location : 2q13
Pathway : Activation of BH3-only proteins, organism-specific biosystem; Activation of BIM and translocation to mitochondria, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem;
Function : contributes_to microtubule binding; microtubule binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy