"BCL2L11" Related Products

Expand
Expand

Recombinant Human BCL2L11 protein, GST-tagged

Cat.No.: BCL2L11-26430TH
Product Overview: Recombinant Human BCL2L11(1 a.a. - 112 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 38.8 kDa
AA Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIL EDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: BCL2L11 BCL2-like 11 (apoptosis facilitator) [ Homo sapiens ]
Official Symbol: BCL2L11
Synonyms: BCL2L11; BCL2-like 11 (apoptosis facilitator); bcl-2-like protein 11; BIM; BimEL; BimL; BOD; bcl2-L-11; bcl-2 interacting protein Bim; bcl-2-related ovarian death agonist; bcl-2 interacting mediator of cell death; BAM; BIM-beta6; BIM-beta7; BIM-alpha6;
Gene ID: 10018
mRNA Refseq: NM_207002
Protein Refseq: NP_996885
MIM: 603827
UniProt ID: O43521
Chromosome Location: 2q13
Pathway: Activation of BH3-only proteins, organism-specific biosystem; Activation of BIM and translocation to mitochondria, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members, organism-specific biosystem; Cell death signalling via NRAGE, NRIF and NADE, organism-specific biosystem;
Function: contributes_to microtubule binding; microtubule binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.