"BMP1" Related Products

Expand
Expand

Recombinant Human BMP1 protein, GST-tagged

Cat.No.: BMP1-26314TH
Product Overview: Recombinant Human BMP1(747 a.a. - 845 a.a.) fused with GST tag at N-terminal was expressed in Wheat germ.
Description: This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region.
Source: Wheat germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.63 kDa
AA Sequence: CDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRF CGSKKPEPVLATGSRMFLRFYSDN
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: BMP1 bone morphogenetic protein 1 [ Homo sapiens ]
Official Symbol: BMP1
Synonyms: BMP1; bone morphogenetic protein 1; PCOLC, procollagen C endopeptidase; procollagen C endopeptidase; procollagen C-proteinase; mammalian tolloid protein; procollagen C-endopeptidase; PCP; TLD; PCP2; PCOLC; FLJ44432;
Gene ID: 649
mRNA Refseq: NM_006129
Protein Refseq: NP_006120
MIM: 112264
UniProt ID: P13497
Chromosome Location: 8p21
Pathway: Adipogenesis, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem;
Function: calcium ion binding; cytokine activity; growth factor activity; metal ion binding; metalloendopeptidase activity; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; peptidase activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.