Recombinant Human BMP1 protein, GST-tagged

• Cat.No.: BMP1-26314TH
• Product Overview: Recombinant Human BMP1(747 a.a. - 845 a.a.) fused with GST tag at N-terminal was expressed in Wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 747-845 a.a.
• Description: This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: CDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRF CGSKKPEPVLATGSRMFLRFYSDN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: BMP1 bone morphogenetic protein 1 [ Homo sapiens ]
• Official Symbol: BMP1
• Synonyms: BMP1; bone morphogenetic protein 1; PCOLC, procollagen C endopeptidase; procollagen C endopeptidase; procollagen C-proteinase; mammalian tolloid protein; procollagen C-endopeptidase; PCP; TLD; PCP2; PCOLC; FLJ44432
• Gene ID: 649
• mRNA Refseq: NM_006129
• Protein Refseq: NP_006120
• MIM: 112264
• UniProt ID: P13497
• Chromosome Location: 8p21
• Pathway: Adipogenesis, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem
• Function: calcium ion binding; cytokine activity; growth factor activity; metal ion binding; metalloendopeptidase activity; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; peptidase activity; zinc ion binding