Recombinant Human BMP1 protein, GST-tagged
| Cat.No. : | BMP1-26314TH |
| Product Overview : | Recombinant Human BMP1(747 a.a. - 845 a.a.) fused with GST tag at N-terminal was expressed in Wheat germ. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 747-845 a.a. |
| Description : | This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | CDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRF CGSKKPEPVLATGSRMFLRFYSDN |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | BMP1 bone morphogenetic protein 1 [ Homo sapiens ] |
| Official Symbol | BMP1 |
| Synonyms | BMP1; bone morphogenetic protein 1; PCOLC, procollagen C endopeptidase; procollagen C endopeptidase; procollagen C-proteinase; mammalian tolloid protein; procollagen C-endopeptidase; PCP; TLD; PCP2; PCOLC; FLJ44432; |
| Gene ID | 649 |
| mRNA Refseq | NM_006129 |
| Protein Refseq | NP_006120 |
| MIM | 112264 |
| UniProt ID | P13497 |
| Chromosome Location | 8p21 |
| Pathway | Adipogenesis, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; |
| Function | calcium ion binding; cytokine activity; growth factor activity; metal ion binding; metalloendopeptidase activity; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; peptidase activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| BMP1-2549H | Recombinant Human BMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BMP1-2548H | Recombinant Human BMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BMP1-26314TH | Recombinant Human BMP1 protein, GST-tagged | +Inquiry |
| BMP1-10247H | Recombinant Human BMP1, His-tagged | +Inquiry |
| Bmp1-663M | Recombinant Mouse Bmp1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP1-8436HCL | Recombinant Human BMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP1 Products
Required fields are marked with *
My Review for All BMP1 Products
Required fields are marked with *
