"BNIP3L" Related Products

Expand
Expand

Recombinant Human BNIP3L

Cat.No.: BNIP3L-26756TH
Product Overview: Recombinant fragment corresponding to amino acids 43-130 of Human BNIP3L with an N terminal proprietary tag; Predicted MWt 35.31 kDa.
Description: This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. This protein counteracts the apoptotic inducer BNIP3 and may play a role in tumor suppression.
Protein length: 88 amino acids
Molecular Weight: 35.310kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
Sequence Similarities: Belongs to the NIP3 family.
Gene Name: BNIP3L BCL2/adenovirus E1B 19kDa interacting protein 3-like [ Homo sapiens ]
Official Symbol: BNIP3L
Synonyms: BNIP3L; BCL2/adenovirus E1B 19kDa interacting protein 3-like; BCL2/adenovirus E1B 19kD interacting protein 3 like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BNIP3a; Nix;
Gene ID: 665
mRNA Refseq: NM_004331
Protein Refseq: NP_004322
MIM: 605368
Uniprot ID: O60238
Chromosome Location: 8p21
Pathway: Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem;
Function: identical protein binding; lamin binding; lamin binding; protein binding; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.