Recombinant Human BNIP3L
| Cat.No. : | BNIP3L-26756TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 43-130 of Human BNIP3L with an N terminal proprietary tag; Predicted MWt 35.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 88 amino acids |
| Description : | This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. This protein counteracts the apoptotic inducer BNIP3 and may play a role in tumor suppression. |
| Molecular Weight : | 35.310kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE |
| Sequence Similarities : | Belongs to the NIP3 family. |
| Gene Name | BNIP3L BCL2/adenovirus E1B 19kDa interacting protein 3-like [ Homo sapiens ] |
| Official Symbol | BNIP3L |
| Synonyms | BNIP3L; BCL2/adenovirus E1B 19kDa interacting protein 3-like; BCL2/adenovirus E1B 19kD interacting protein 3 like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BNIP3a; Nix; |
| Gene ID | 665 |
| mRNA Refseq | NM_004331 |
| Protein Refseq | NP_004322 |
| MIM | 605368 |
| Uniprot ID | O60238 |
| Chromosome Location | 8p21 |
| Pathway | Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; |
| Function | identical protein binding; lamin binding; lamin binding; protein binding; protein heterodimerization activity; |
| ◆ Recombinant Proteins | ||
| BNIP3L-1063M | Recombinant Mouse BNIP3L Protein, His (Fc)-Avi-tagged | +Inquiry |
| BNIP3L-7854H | Recombinant Human BNIP3L protein, His-tagged | +Inquiry |
| BNIP3L-347C | Recombinant Cynomolgus BNIP3L Protein, His-tagged | +Inquiry |
| BNIP3L-2449M | Recombinant Mouse BNIP3L Protein | +Inquiry |
| BNIP3L-1342H | Recombinant Human BNIP3L Protein (1-219 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BNIP3L-8422HCL | Recombinant Human BNIP3L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BNIP3L Products
Required fields are marked with *
My Review for All BNIP3L Products
Required fields are marked with *
