Recombinant Human BNIP3L protein, His-tagged

• Cat.No.: BNIP3L-7854H
• Product Overview: Recombinant Human BNIP3L protein(77-146 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 77-146 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: DAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: BNIP3L BCL2/adenovirus E1B 19kDa interacting protein 3-like [ Homo sapiens ]
• Official Symbol: BNIP3L
• Synonyms: BNIP3L; BCL2/adenovirus E1B 19kDa interacting protein 3-like; BCL2/adenovirus E1B 19kD interacting protein 3 like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BNIP3a; Nix; NIP3L; NIP3-like protein X; adenovirus E1B19k-binding protein B5; BCL2/adenovirus E1B 19-kd protein-interacting protein 3a; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A; NIX
• Gene ID: 665
• mRNA Refseq: NM_004331
• Protein Refseq: NP_004322
• MIM: 605368
• UniProt ID: O60238