"BPHL" Related Products

Expand
Expand

Recombinant Human BPHL, His-tagged

Cat.No.: BPHL-27669TH
Product Overview: Recombinant full length Human BPHL with N terminal His tag; 275 amino acids with tag, MWt 31.1 kDa.
Description: This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described.
Protein length: 254 amino acids
Conjugation: HIS
Molecular Weight: 31.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Sequence Similarities: Belongs to the AB hydrolase superfamily. Lipase family.
Gene Name: BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ]
Official Symbol: BPHL
Synonyms: BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen;
Gene ID: 670
mRNA Refseq: NM_004332
Protein Refseq: NP_004323
MIM: 603156
Uniprot ID: Q86WA6
Chromosome Location: 6p25
Function: hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.