Recombinant Human BPHL, His-tagged

Cat.No. : BPHL-27669TH
Product Overview : Recombinant full length Human BPHL with N terminal His tag; 275 amino acids with tag, MWt 31.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 254 amino acids
Description : This gene encodes a member of the serine protease family of hydrolytic enzymes which contain a serine in their active site. The encoded protein may play a role in activation of the antiviral prodrug valacyclovir. Alternatively spliced transcript variants have been described.
Conjugation : HIS
Molecular Weight : 31.100kDa inclusive of tags
Tissue specificity : Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Sequence Similarities : Belongs to the AB hydrolase superfamily. Lipase family.
Gene Name BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ]
Official Symbol BPHL
Synonyms BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen;
Gene ID 670
mRNA Refseq NM_004332
Protein Refseq NP_004323
MIM 603156
Uniprot ID Q86WA6
Chromosome Location 6p25
Function hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BPHL Products

Required fields are marked with *

My Review for All BPHL Products

Required fields are marked with *

0
cart-icon
0
compare icon