Recombinant Human BSG

• Cat.No.: BSG-27216TH
• Product Overview: Recombinant fragment of Human CD147 (amino acids 206-305) with N terminal proprietary tag, 36.63kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTS
• Sequence Similarities: Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Gene Information

• Gene Name: BSG basigin (Ok blood group) [ Homo sapiens ]
• Official Symbol: BSG
• Synonyms: BSG; basigin (Ok blood group); basigin (OK blood group) , OK; basigin; CD147; EMMPRIN
• Gene ID: 682
• mRNA Refseq: NM_001728
• Protein Refseq: NP_001719
• MIM: 109480
• Uniprot ID: P35613
• Chromosome Location: 19p13.3
• Pathway: Basigin interactions, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem
• Function: lactate transmembrane transporter activity; mannose binding; sugar binding