"BSG" Related Products

Expand
Expand
Expand

Recombinant Human BSG

Cat.No. : BSG-27216TH
Product Overview : Recombinant fragment of Human CD147 (amino acids 206-305) with N terminal proprietary tag, 36.63kDa inclusive of tag.
Description : The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Present only in vascular endothelium in non-neoplastic regions of the brain, whereas it is present in tumor cells but not in proliferating blood vessels in malignant gliomas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTS
Sequence Similarities : Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name : BSG basigin (Ok blood group) [ Homo sapiens ]
Official Symbol : BSG
Synonyms : BSG; basigin (Ok blood group); basigin (OK blood group) , OK; basigin; CD147; EMMPRIN;
Gene ID : 682
mRNA Refseq : NM_001728
Protein Refseq : NP_001719
MIM : 109480
Uniprot ID : P35613
Chromosome Location : 19p13.3
Pathway : Basigin interactions, organism-specific biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Integrin cell surface interactions, organism-specific biosystem; Matrix Metalloproteinases, organism-specific biosystem;
Function : lactate transmembrane transporter activity; mannose binding; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.