Recombinant Human CA12

• Cat.No.: CA12-26248TH
• Product Overview: Recombinant fragment corresponding to amino acids 25-124 of Human CA12 with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. O43570,

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Highly expressed in colon, kidney, prostate, intestine and activated lymphocytes. Expressed at much higher levels in the renal cell cancers than in surrounding normal kidney tissue. Moderately expressed in pancreas, ovary and testis.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN
• Sequence Similarities: Belongs to the alpha-carbonic anhydrase family.

Gene Information

• Gene Name: CA12 carbonic anhydrase XII [ Homo sapiens ]
• Official Symbol: CA12
• Synonyms: CA12; carbonic anhydrase XII; carbonic anhydrase 12; HsT18816
• Gene ID: 771
• mRNA Refseq: NM_001218
• Protein Refseq: NP_001209
• MIM: 603263
• Uniprot ID: O43570
• Chromosome Location: 15q22
• Pathway: Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem
• Function: carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding