"CA12" Related Products

Expand

Recombinant Human CA12

Cat.No.: CA12-26248TH
Product Overview: Recombinant fragment corresponding to amino acids 25-124 of Human CA12 with N terminal proprietary tag; predicted MWt 36.63 kDa inclusive of tag. O43570,
Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Two transcript variants encoding different isoforms have been identified for this gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in colon, kidney, prostate, intestine and activated lymphocytes. Expressed at much higher levels in the renal cell cancers than in surrounding normal kidney tissue. Moderately expressed in pancreas, ovary and testis.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN
Sequence Similarities: Belongs to the alpha-carbonic anhydrase family.
Gene Name: CA12 carbonic anhydrase XII [ Homo sapiens ]
Official Symbol: CA12
Synonyms: CA12; carbonic anhydrase XII; carbonic anhydrase 12; HsT18816;
Gene ID: 771
mRNA Refseq: NM_001218
Protein Refseq: NP_001209
MIM: 603263
Uniprot ID: O43570
Chromosome Location: 15q22
Pathway: Nitrogen metabolism, organism-specific biosystem; Nitrogen metabolism, conserved biosystem;
Function: carbonate dehydratase activity; lyase activity; metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.