"CAPN2" Related Products

Expand
Expand

Recombinant Human CAPN2

Cat.No.: CAPN2-27400TH
Product Overview: Recombinant full length Human Calpain 2 with N terminal proprietary tag; Predicted MWt 103.07.
Description: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 2. Multiple heterogeneous transcriptional start sites in the 5 UTR have been reported. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 700 amino acids
Molecular Weight: 103.070kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECL EAGTLFQDPSFPAIPSALGFKELGPYSSKTRGIEWKRPTE ICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPT KDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGAT TEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQK LIRIRNPWGEVEWTGRWNDNCPSWNTIDPEERERLTRRHE DGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEED GESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEEL SGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANL EEFDISEDDIDDGFRRLFAQLAGEDAEISAFELQTILRRV LAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPC QLHQVIVARFADDQLIIDFDNFVRCLVRLETLFKIFKQLD PENTGTIELDLISWLCFSVL
Sequence Similarities: Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 3 EF-hand domains.
Gene Name: CAPN2 calpain 2, (m/II) large subunit [ Homo sapiens ]
Official Symbol: CAPN2
Synonyms: CAPN2; calpain 2, (m/II) large subunit; calpain-2 catalytic subunit; CANPL2; CANPml; mCANP;
Gene ID: 824
mRNA Refseq: NM_001146068
Protein Refseq: NP_001139540
MIM: 114230
Uniprot ID: P17655
Chromosome Location: 1q41-q42
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; ErbB1 downstream signaling, organism-specific biosystem;
Function: calcium ion binding; calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; cytoskeletal protein binding; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.