"CBS" Related Products

Expand
Expand

Recombinant Human CBS, His-tagged

Cat.No.: CBS-27861TH
Product Overview: Recombinant fragment, corresponding to amino acids 242-551 of Human CBS with N terminal His tag; MWt 38kDa.
Description: The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. Multiple alternatively spliced transcript variants have been found for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: In the adult strongly expressed in liver and pancreas, some expression in heart and brain, weak expression in lung and kidney. In the fetus, expressed in brain, liver and kidney.
Form: Lyophilised:Reconstitute with 153 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVD PEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTV VDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVA VKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKG FLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTI EILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKV QPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALV VHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERD QK
Sequence Similarities: Belongs to the cysteine synthase/cystathionine beta-synthase family.Contains 1 CBS domain.
Gene Name: CBS cystathionine-beta-synthase [ Homo sapiens ]
Official Symbol: CBS
Synonyms: CBS; cystathionine-beta-synthase; cystathionine beta-synthase; HIP4;
Gene ID: 875
mRNA Refseq: NM_000071
Protein Refseq: NP_000062
MIM: 613381
Uniprot ID: P35520
Chromosome Location: 21q22.3
Pathway: Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Cysteine biosynthesis, homocysteine + serine => cysteine, organism-specific biosystem; Cysteine biosynthesis, homocysteine + serine =>
Function: cystathionine beta-synthase activity; enzyme binding; heme binding; heme binding; lyase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.