Recombinant Human CCR2
| Cat.No. : | CCR2-27804TH |
| Product Overview : | Recombinant fragment (amino acids 1-42) of Human CCR2 with a proprietarytag at the N terminal; 42 amino acids, Predicted MW 30.25 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 42 amino acids |
| Description : | This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene. |
| Molecular Weight : | 30.250kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
| Gene Name | CCR2 chemokine (C-C motif) receptor 2 [ Homo sapiens ] |
| Official Symbol | CCR2 |
| Synonyms | CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R; |
| Gene ID | 1231 |
| MIM | 601267 |
| Uniprot ID | P41597 |
| Chromosome Location | 3p21 |
| Pathway | Chemokine receptors bind chemokines, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
| ◆ Recombinant Proteins | ||
| CCR2-15HB | Active Recombinant Human CCR2 protein, Biotinylated | +Inquiry |
| CCR2-1227R | Recombinant Rat CCR2 Protein | +Inquiry |
| CCR2-0689H | Recombinant Human CCR2 Protein, GST-Tagged | +Inquiry |
| Ccr2-4321M | Recombinant Mouse Ccr2 protein, His&Myc-tagged | +Inquiry |
| CCR2-3014M | Recombinant Mouse chemokine (C-C motif) receptor 2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCR2-7696HCL | Recombinant Human CCR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCR2 Products
Required fields are marked with *
My Review for All CCR2 Products
Required fields are marked with *



