Recombinant Mouse Ccr2 protein, His&Myc-tagged

Cat.No. : Ccr2-4321M
Product Overview : Recombinant Mouse Ccr2 protein(P51683)(1-55aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 1-55aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 13.6 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGA
Gene Name Ccr2 chemokine (C-C motif) receptor 2 [ Mus musculus ]
Official Symbol Ccr2
Synonyms CCR2; chemokine (C-C motif) receptor 2; C-C chemokine receptor type 2; CCR-2; C-C CKR-2; MIP-1 alphaR; MCP-1 receptor; JE/FIC receptor; chemokine (C-C) receptor 2; chemoattractant protein-1 receptor; C-C CHEMOKINE RECEPTOR TYPE 2 (C-C CKR-2) (CC-CKR-2) (CCR-2) (CCR2) (JE/FIC RECEPTOR) (MCP-1 RECEPTOR); Ckr2; Ccr2a; Ccr2b; Ckr2a; Ckr2b; mJe-r; Cmkbr2; Cc-ckr-2;
Gene ID 12772
mRNA Refseq NM_009915
Protein Refseq NP_034045

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccr2 Products

Required fields are marked with *

My Review for All Ccr2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon