Recombinant Human CCR2 Protein, GST-Tagged
Cat.No. : | CCR2-0689H |
Product Overview : | Human CCR2 partial ORF (NP_000639, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene. [provided by RefSeq, Mar 2009] |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 30.36 kDa |
AA Sequence : | MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | CCR2 chemokine (C-C motif) receptor 2 [ Homo sapiens ] |
Official Symbol : | CCR2 |
Synonyms : | CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R; CCR2A; CCR2B; CKR2A; CKR2B; MCP-1-R; CC-CKR-2; |
Gene ID : | 729230 |
mRNA Refseq : | NM_001123041 |
Protein Refseq : | NP_001116513 |
MIM : | 601267 |
UniProt ID : | P41597 |
Products Types
◆ Recombinant Protein | ||
CCR2-3014M | Recombinant Mouse CCR2 Protein, His-tagged | +Inquiry |
CCR2-885R | Recombinant Rat CCR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCR2-705R | Recombinant Rhesus Monkey CCR2 Protein, His-tagged | +Inquiry |
CCR2-135H | Recombinant Human CCR2 Protein | +Inquiry |
CCR2-1227R | Recombinant Rat CCR2 Protein | +Inquiry |
◆ Lysates | ||
CCR2-7696HCL | Recombinant Human CCR2 293 Cell Lysate | +Inquiry |
◆ Assay kits | ||
Kit-1150 | CCR2 CHO-K1 β-Arrestin GPCR Assay Kit | +Inquiry |
Kit-1637 | CHO-K1 CCR2 Bioassay Kit | +Inquiry |
Kit-1638 | CCR2 Total GPCR Internalization Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionAntagonists of multiple CCR2 proteins have been developed to inhibit the binding of CCR2 to its ligand CCL2, thereby regulating the inflammatory response and migration of immune cells.
CCR2 protein plays an important role in the field of immune inflammation, and studying the function and regulatory mechanism of CCR2 protein will help the development of new drugs, for example, antagonists targeting CCR2 protein may be applied to the treatment of inflammatory diseases.
The CCR2 protein plays an important role in the migration and activation of macrophages and may therefore be involved in the initiation and progression of infectious diseases.
There are no specific diagnostic methods for the CCR2 protein, but the CCR2 protein could be a potential candidate for inflammatory markers.
By binding to its ligand CCL2, CCR2 protein regulates the release of inflammatory mediators, the migration of immune cells, and the occurrence of inflammatory responses.
CCR2 protein plays an important role in the activation and migration of immune cells, so it can be used in immune vaccine design to promote immune cell infiltration and antigen presentation.
Customer Reviews (3)
Write a reviewThis reproducibility of CCR2 was very good, showing good production process and quality control.
I appreciate the attention paid to product quality by the producers of CCR2, and their product is very stable, which makes our experiments smoother.
The bands of CCR2 in Western blot were regular in shape and showed good quality.
Ask a Question for All CCR2 Products
Required fields are marked with *
My Review for All CCR2 Products
Required fields are marked with *
Inquiry Basket