Recombinant Human CCR2 Protein, GST-Tagged

Cat.No. : CCR2-0689H
Product Overview : Human CCR2 partial ORF (NP_000639, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene. [provided by RefSeq, Mar 2009]
Molecular Mass : 30.36 kDa
AA Sequence : MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCR2 chemokine (C-C motif) receptor 2 [ Homo sapiens ]
Official Symbol CCR2
Synonyms CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R; CCR2A; CCR2B; CKR2A; CKR2B; MCP-1-R; CC-CKR-2;
Gene ID 729230
mRNA Refseq NM_001123041
Protein Refseq NP_001116513
MIM 601267
UniProt ID P41597

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCR2 Products

Required fields are marked with *

My Review for All CCR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon