"CCR2" Related Products

Expand
Expand
Expand

Recombinant Human CCR2 Protein, GST-Tagged

Cat.No.: CCR2-0689H
Product Overview: Human CCR2 partial ORF (NP_000639, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene. [provided by RefSeq, Mar 2009]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 30.36 kDa
AA Sequence: MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: CCR2 chemokine (C-C motif) receptor 2 [ Homo sapiens ]
Official Symbol: CCR2
Synonyms: CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R; CCR2A; CCR2B; CKR2A; CKR2B; MCP-1-R; CC-CKR-2;
Gene ID: 729230
mRNA Refseq: NM_001123041
Protein Refseq: NP_001116513
MIM: 601267
UniProt ID: P41597

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.