Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at BIO-Europe Spring|March 18–20, 2024|Booth #34

Recombinant Human CCR2 Protein, GST-Tagged

Cat.No. : CCR2-0689H
Product Overview : Human CCR2 partial ORF (NP_000639, 1 a.a. - 42 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene. [provided by RefSeq, Mar 2009]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 30.36 kDa
AA Sequence : MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : CCR2 chemokine (C-C motif) receptor 2 [ Homo sapiens ]
Official Symbol : CCR2
Synonyms : CCR2; chemokine (C-C motif) receptor 2; CMKBR2; CC CKR 2; CD192; CKR2; FLJ78302; MCP 1 R; CCR2A; CCR2B; CKR2A; CKR2B; MCP-1-R; CC-CKR-2;
Gene ID : 729230
mRNA Refseq : NM_001123041
Protein Refseq : NP_001116513
MIM : 601267
UniProt ID : P41597

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
Which drugs interact with CCR2 proteins? 12/30/2019

Antagonists of multiple CCR2 proteins have been developed to inhibit the binding of CCR2 to its ligand CCL2, thereby regulating the inflammatory response and migration of immune cells.

Does CCR2 protein research have implications for new drug development? 12/16/2019

CCR2 protein plays an important role in the field of immune inflammation, and studying the function and regulatory mechanism of CCR2 protein will help the development of new drugs, for example, antagonists targeting CCR2 protein may be applied to the treatment of inflammatory diseases.

What is the role of CCR2 protein in infectious diseases? 12/06/2019

The CCR2 protein plays an important role in the migration and activation of macrophages and may therefore be involved in the initiation and progression of infectious diseases.

Has a diagnostic method been developed to interact with the CCR2 protein? 06/08/2019

There are no specific diagnostic methods for the CCR2 protein, but the CCR2 protein could be a potential candidate for inflammatory markers.

What is the mechanism of action of CCR2 protein in inflammatory response? 05/18/2019

By binding to its ligand CCL2, CCR2 protein regulates the release of inflammatory mediators, the migration of immune cells, and the occurrence of inflammatory responses.

What are the potential applications of CCR2 protein in immune vaccine design? 05/05/2019

CCR2 protein plays an important role in the activation and migration of immune cells, so it can be used in immune vaccine design to promote immune cell infiltration and antigen presentation.

Customer Reviews (3)

Write a review
Reviews
06/03/2022

    This reproducibility of CCR2 was very good, showing good production process and quality control.

    12/10/2020

      I appreciate the attention paid to product quality by the producers of CCR2, and their product is very stable, which makes our experiments smoother.

      10/22/2019

        The bands of CCR2 in Western blot were regular in shape and showed good quality.

        Ask a Question for All CCR2 Products

        Required fields are marked with *

        My Review for All CCR2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends