"CD1D" Related Products

Recombinant Human CD1D

Cat.No.: CD1D-27107TH
Product Overview: Recombinant full length Human CD1d with N terminal proprietary tag; predicted MW 62.59 kDa.
Description: This gene encodes a divergent member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail.
Protein length: 335 amino acids
Molecular Weight: 62.590kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSS WTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQ WETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGC EVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVN LAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELK KQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMR GEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVG FTSRFKRQTSYQGVL
Sequence Similarities: Contains 1 Ig-like (immunoglobulin-like) domain.
Gene Name: CD1D CD1d molecule [ Homo sapiens ]
Official Symbol: CD1D
Synonyms: CD1D; CD1d molecule; CD1d antigen , CD1D antigen, d polypeptide; antigen-presenting glycoprotein CD1d;
Gene ID: 912
mRNA Refseq: NM_001766
Protein Refseq: NP_001757
MIM: 188410
Uniprot ID: P15813
Chromosome Location: 1q22-q23
Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: beta-2-microglobulin binding; exogenous lipid antigen binding; histone binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.