Recombinant Human CD5 CD5-26633TH

Recombinant Human CD5

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD5

Recombinant Human CD5

CD5 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD5-26633TH
Product Overview : Recombinant full length Human CD5 with N terminal proprietary tag; predicted MWt: 80.96 kDa including the tag.
Description : CD5 is a cluster of differentiation found on a subset of IgM-secreting B cells called B-1 cells, and also on T cells.
Protein length : 495 amino acids
Molecular Weight : 80.960kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRS NSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKV CQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHS RNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQ LVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFL CNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQ NSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVG GSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQ CGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYC KKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPL AYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH AENPTASHVDNEYSQPPRNSRLSAYPALEGVLHRSSMQPD NSSDSDYDLHGAQRL
Gene Name : CD5 CD5 molecule [ Homo sapiens ]
Official Symbol : CD5
Synonyms : CD5; CD5 molecule; CD5 antigen (p56 62) , LEU1; T-cell surface glycoprotein CD5; T1;
Gene ID : 921
mRNA Refseq : NM_014207
Protein Refseq : NP_055022
MIM : 153340
Uniprot ID : P06127
Chromosome Location : 11q13
Pathway : B Cell Receptor Signaling Pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; T Cell Receptor Signaling Pathway, organism-specific biosystem;
Function : glycoprotein binding; protein binding; receptor activity; scavenger receptor activity; transmembrane signaling receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy