"CD69" Related Products

Expand
Expand

Recombinant Human CD69

Cat.No.: CD69-27505TH
Product Overview: Recombinant fragment corresponding to amino acids 90-199 of Human CD69 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
Description: This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDM NFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTG SDKCVFLKNTEVSSMECEKNLYWICNKPYK
Sequence Similarities: Contains 1 C-type lectin domain.
Gene Name: CD69 CD69 molecule [ Homo sapiens ]
Official Symbol: CD69
Synonyms: CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C;
Gene ID: 969
mRNA Refseq: NM_001781
Protein Refseq: NP_001772
MIM: 107273
Uniprot ID: Q07108
Chromosome Location: 12p13
Function: binding; sugar binding; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.