Recombinant Human CD69 CD69-27505TH

Recombinant Human CD69

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD69

Recombinant Human CD69

CD69 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD69-27505TH
Product Overview : Recombinant fragment corresponding to amino acids 90-199 of Human CD69 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.
Description : This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDM NFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTG SDKCVFLKNTEVSSMECEKNLYWICNKPYK
Sequence Similarities : Contains 1 C-type lectin domain.
Gene Name : CD69 CD69 molecule [ Homo sapiens ]
Official Symbol : CD69
Synonyms : CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C;
Gene ID : 969
mRNA Refseq : NM_001781
Protein Refseq : NP_001772
MIM : 107273
Uniprot ID : Q07108
Chromosome Location : 12p13
Function : binding; sugar binding; transmembrane signaling receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy