Recombinant Human CD69
Cat.No. : | CD69-27505TH |
Product Overview : | Recombinant fragment corresponding to amino acids 90-199 of Human CD69 with an N terminal proprietary tag; Predicted MWt 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDM NFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTG SDKCVFLKNTEVSSMECEKNLYWICNKPYK |
Sequence Similarities : | Contains 1 C-type lectin domain. |
Gene Name | CD69 CD69 molecule [ Homo sapiens ] |
Official Symbol | CD69 |
Synonyms | CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C; |
Gene ID | 969 |
mRNA Refseq | NM_001781 |
Protein Refseq | NP_001772 |
MIM | 107273 |
Uniprot ID | Q07108 |
Chromosome Location | 12p13 |
Function | binding; sugar binding; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
CD69-2636H | Recombinant Human CD69 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD69-1101H | Recombinant Human CD69 Protein (Ser62-Lys199), His tagged | +Inquiry |
CD69-3028HF | Recombinant Full Length Human CD69 Protein, GST-tagged | +Inquiry |
CD69-1487C | Recombinant Cynomolgus CD69 protein, His-tagged | +Inquiry |
CD69-2032H | Recombinant Human CD69 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD69-2573HCL | Recombinant Human CD69 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD69 Products
Required fields are marked with *
My Review for All CD69 Products
Required fields are marked with *