Recombinant Human CD69

• Cat.No.: CD69-27505TH
• Product Overview: Recombinant fragment corresponding to amino acids 90-199 of Human CD69 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
• Molecular Weight: 37.730kDa inclusive of tags
• Tissue specificity: Expressed on the surface of activated T-cells, B-cells, natural killer cells, neutrophils, eosinophils, epidermal Langerhans cells and platelets.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDM NFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTG SDKCVFLKNTEVSSMECEKNLYWICNKPYK
• Sequence Similarities: Contains 1 C-type lectin domain.

Gene Information

• Gene Name: CD69 CD69 molecule [ Homo sapiens ]
• Official Symbol: CD69
• Synonyms: CD69; CD69 molecule; CD69 antigen (p60, early T cell activation antigen); early activation antigen CD69; CLEC2C
• Gene ID: 969
• mRNA Refseq: NM_001781
• Protein Refseq: NP_001772
• MIM: 107273
• Uniprot ID: Q07108
• Chromosome Location: 12p13
• Function: binding; sugar binding; transmembrane signaling receptor activity