"CD80" Related Products

Recombinant Human CD80, Fc-tagged

Cat.No.: CD80-27510TH
Product Overview: Recombinant human CD80-Fc fusion protein containing the extracellular domain of human CD80 fused to Human Fc.
Description: The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy.
Conjugation: Fc
Tissue specificity: Expressed on activated B-cells, macrophages and dendritic cells.
Form: Liquid
Purity: Protein A purified
Storage buffer: Preservative: NoneConstituents: PBS, pH 7.2
Storage: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTK EVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGD MNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRI ICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAV SSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP DDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALHNHYTQKSLSLSPGKExtracel lular domain (amino acids 1-241) of human B7.1 sequence is underlined.Human Fc sequence is in italics.
Sequence Similarities: Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 Ig-like V-type (immunoglobulin-like) domain.
Gene Name: CD80 CD80 molecule [ Homo sapiens ]
Official Symbol: CD80
Synonyms: CD80; CD80 molecule; CD28LG, CD28LG1, CD80 antigen (CD28 antigen ligand 1, B7 1 antigen) , CD80 molecule; T-lymphocyte activation antigen CD80; B lymphocyte activation antigen B7; B7 1; B7.1;
Gene ID: 941
mRNA Refseq: NM_005191
Protein Refseq: NP_005182
MIM: 112203
Uniprot ID: P33681
Chromosome Location: 3q13.3-q21
Pathway: Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem;
Function: coreceptor activity; protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.