Recombinant Full Length Human CD80 Protein, C-Flag-tagged
Cat.No. : | CD80-1232HFL |
Product Overview : | Recombinant Full Length Human CD80 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a membrane receptor that is activated by the binding of CD28 or CTLA-4. The activated protein induces T-cell proliferation and cytokine production. This protein can act as a receptor for adenovirus subgroup B and may play a role in lupus neuropathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.3 kDa |
AA Sequence : | MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEK KMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKA DFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTT NHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERL RRESVRPVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors, Transmembrane |
Protein Pathways : | Allograft rejection, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Toll-like receptor signaling pathway, Type I diabetes mellitus, Viral myocarditis |
Full Length : | Full L. |
Gene Name | CD80 CD80 molecule [ Homo sapiens (human) ] |
Official Symbol | CD80 |
Synonyms | B7; BB1; B7-1; B7.1; LAB7; CD28LG; CD28LG1 |
Gene ID | 941 |
mRNA Refseq | NM_005191.4 |
Protein Refseq | NP_005182.1 |
MIM | 112203 |
UniProt ID | P33681 |
◆ Recombinant Proteins | ||
Cd80-1068R | Recombinant Rat Cd80 Protein, Fc-tagged | +Inquiry |
CD80-587C | Recombinant Cynomolgus monkey CD80 Protein, Fc-tagged | +Inquiry |
CD80-0859H | Recombinant Human CD80 Protein | +Inquiry |
CD80-589HF | Recombinant Human CD80 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
CD80-591HAF555 | Recombinant Human CD80 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD80-948CCL | Recombinant Cynomolgus CD80 cell lysate | +Inquiry |
CD80-1767MCL | Recombinant Mouse CD80 cell lysate | +Inquiry |
CD80-2715HCL | Recombinant Human CD80 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD80 Products
Required fields are marked with *
My Review for All CD80 Products
Required fields are marked with *
0
Inquiry Basket